KEGG   Gallus gallus (chicken): 416867Help
Entry
416867            CDS       T01006                                 

Gene name
VPS29
Definition
(RefSeq) vacuolar protein sorting-associated protein 29
  KO
K18467  vacuolar protein sorting-associated protein 29
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    416867 (VPS29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416867 (VPS29)
Membrane trafficking [BR:gga04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    416867 (VPS29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 416867
NCBI-ProteinID: NP_001007838
CGNC: 50361
Ensembl: ENSGALG00000004529
UniProt: Q5ZIL2
Position
15
AA seq 186 aa AA seqDB search
MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKDTYDYLKTLAGDV
HVVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHT
HKFEAFEHENKFYINPGSATGAYHALENNIIPSFVLMDIQASTVVTYVYQLIGDDVKVER
IEYKKS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcacagattggtgttagtattaggagatcttcacattccacatcgatgcaac
agcctcccggccaagttcaaaaagctgctggttccagggaagatccagcacatcctctgc
acgggaaacctctgcaccaaggacacttatgactacctcaagaccctggctggggatgtt
catgttgtcagaggggactttgatgagaacctgaattatcctgaacagaaagttgtaact
gttggacagttcaaaattggtctgattcacggccaccaggtcattccctggggtgatatg
gccagcctggcactgctacagaggcagtttgatgtggacatcctcatttcaggacataca
cacaaatttgaggcatttgaacatgaaaacaagttctatatcaatccaggatcagctaca
ggagcttatcatgccttagagaacaacatcatcccgtcatttgtgctgatggatatccag
gcttctacagtagtcacgtacgtctatcagctaattggagatgatgtgaaagtagaaaga
attgagtacaaaaaatcttaa

DBGET integrated database retrieval system