KEGG   Gallus gallus (chicken): 416874
Entry
416874            CDS       T01006                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2A, cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04530  Tight junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    416874 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    416874 (MYL2)
   04530 Tight junction
    416874 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    416874 (MYL2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    416874 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    416874 (MYL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    416874 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    416874 (MYL2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     416874 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 416874
NCBI-ProteinID: NP_001258858
CGNC: 50364
Ensembl: ENSGALG00000004582
Position
15
AA seq 165 aa
MAPKKAKKRIEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKADLRDTFAALGRLN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGLKSAYIKE
MLMTQGERFSQEEIDQMFAAFPPDVSGNLDYKNLVHVITHGEEKD
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcacccaagaaagccaagaagaggattgaaggtgcgaattccaatgtcttctccatg
ttcgagcaggcccagatccaggaattcaaagaggcgttcaccatcatggatcagaaccga
gacggcttcatcgacaaggcagacctgagagatacatttgctgcactcgggcgcctgaat
gtgaaaaacgaggagatcgatgagatgatcaaggaggcacctggcccaatcaacttcact
gtgttcctcaccatgtttggggagaaactcaagggtgctgatccagaggagacgatcctg
aacgcgttcaaggtgtttgatccggagggcaaagggctgaaatctgcctacatcaaagaa
atgctgatgacgcagggcgagaggttttcccaggaggagatcgatcagatgtttgctgcc
ttccctccagacgtctccggcaacctcgactacaaaaacctcgtccacgtcatcacacac
ggagaggagaaggactaa

DBGET integrated database retrieval system