KEGG   Gallus gallus (chicken): 416882
Entry
416882            CDS       T01006                                 

Gene name
ERP29
Definition
(RefSeq) endoplasmic reticulum resident protein 29 precursor
  KO
K09586  endoplasmic reticulum protein 29
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    416882 (ERP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    416882 (ERP29)
   04131 Membrane trafficking [BR:gga04131]
    416882 (ERP29)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   416882 (ERP29)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    416882 (ERP29)
SSDB
Motif
Pfam: ERp29_N ERp29 PRTase_1 DUF4559
Other DBs
NCBI-GeneID: 416882
NCBI-ProteinID: NP_001263253
CGNC: 50366
Ensembl: ENSGALG00000023510
UniProt: P81628 F1NRM8
Position
15
AA seq 252 aa
MAAAAAAGSLLLCLLGLALPGSALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEK
QDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFQDGDFDNP
LPYSGHIKAGAIQRWLKSNGIYLGMPGCLKEYDVLASKFMSVTDKSERQSLLKKGQQSLE
KAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLIEKNKMSDGKKEELQKSLNILA
SFLKKNNEKDEL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggctgcggcggccgctgccggctcgctgctcctctgcttgctcggcttggcgctgccc
ggcagcgcgctgcacaccaagggctccgtgcccctcgacaccatcaccttttacaaggtg
atcccaaagcataagtttgtccttgtgaagtttgatacgcagtacccttacggcgagaaa
caagatgagttcaaaaagctggcagagagctcaggctccagtgaagatcttctggtggct
gaagtgggaatatcagactatggtgataaactgaacactgagctgggagaaaagtacaag
ctggacaaggagaagtaccctatcttttatttgttccaggatggtgactttgacaatccc
ttaccttactctggccacattaaagccggggctattcagcgctggctgaagagtaatggc
atctacctggggatgccgggctgtctgaaggagtatgatgtgctggccagcaagtttatg
agtgtcactgacaagtcagaacgccagtccctcctgaagaaggggcagcagagcttagag
aaagcaaaggagactgagaagaagtcagctgagcaatacttgaaaattatgagcaagata
ctggagcagggagaagagtttgctgctaacgaagttgtccgaatcacaaaactgattgag
aagaacaaaatgagtgatggaaaaaaggaggagctccagaaaagcctcaatatcctcgct
tctttcctaaagaagaataatgaaaaagatgagctctga

DBGET integrated database retrieval system