KEGG   Gallus gallus (chicken): 416898
Entry
416898            CDS       T01006                                 

Gene name
FOXN4
Definition
(RefSeq) forkhead box protein N4
  KO
K09407  forkhead box protein N
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    416898 (FOXN4)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    416898 (FOXN4)
SSDB
Motif
Pfam: Forkhead Ribosomal_L30_N
Other DBs
NCBI-GeneID: 416898
NCBI-ProteinID: NP_001076828
CGNC: 50371
Ensembl: ENSGALG00000005062
UniProt: A3EYS4
Position
15
AA seq 513 aa
MIESDLPSMMSGLIRSSGHSQHAAQEYRLLASDPSQLSEDDLPSDLQSLSWLTSVDVPRL
QQMASGRMDFGLGAQNAMLQQTGPVASNMHSTGAPGAMIHVQASLPQGVLGLNSISSHGA
SMNQYSVGGQPSPSLQTQQQLFPPHPQQVFAIAQNTQQCNPAAIYNTSYATQPHYPQPRL
APHSAQELHPKHYPKPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKTAPDGWK
NSVRHNLSLNKCFEKVENKMSGTSRKGCLWALNPAKIDKMEEEMQKWKRKDLAAIHRSMA
NPEELDKLITDRPENCRRSSKQAEPEISTLNHMAAAQGRISISQLQPQPIMTLSLQSVPL
HHQIQTQARITPDSPAPAQTPPLHTLPDISHSPLPHHPMGRAPPDFLNMTADMNTEVDAL
DPSIMDFALQGNIWEEMKDDSFSLDTLGAFSNSPLHLSDCDLGTPGLTPISSGSDHSLSD
FQVTGLYTTYTSVDNIAAAQYMNPQGNKPIALL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgatagagagcgatctcccgtccatgatgtcaggactcatccggagctcagggcacagc
cagcacgctgcccaggagtacaggctcttagcttctgacccctcccagctgagcgaagat
gacctccccagtgacttgcagtccttgtcatggctgacatctgttgatgtccctcggtta
caacagatggccagtggaagaatggattttggccttggtgcccagaatgcaatgctacaa
cagacaggtcctgtggcaagcaacatgcactccacgggagcacctggagcaatgattcat
gtccaggccagcctgccacagggagtcctgggactgaattctatttcatcacatggagca
agtatgaaccagtactctgtaggtgggcagccctctcctagtttacagacacagcagcag
ctcttccctcctcatccacagcaagtgtttgccatagcccagaatacacaacagtgtaac
ccagcagcaatctacaacacatcgtatgccactcagccacattatcctcagccacgcctg
gctcctcactctgcccaagaactgcatccaaaacattaccccaagcccatctattcgtac
agttgcttaattgcaatggcactgaagaacagcaaaacaggcagcctccccgtgagtgag
atctacagcttcatgaaggaacactttccctacttcaagacagcccccgatggctggaaa
aactccgtgcgccataacctgtccctgaataagtgttttgagaaagtggagaacaagatg
agtggcacctctcgcaagggatgcctgtgggctctcaatcctgccaagattgacaaaatg
gaagaggagatgcagaagtggaagcggaaggacttagctgccattcacaggagcatggct
aacccagaggagctggacaagctgattactgacagacctgagaactgcaggcgctccagt
aaacaggcagaacctgagatctctaccctgaaccacatggcagcagcccaaggccgaatc
tccatctcccagctgcagccccaaccgatcatgactctctcgctgcagtctgtccctctg
catcaccagatccagacccaggctcgcatcacgccggactccccagcacctgcacagaca
cctcctctccacactctgcctgacatcagccacagccctctgccccaccaccccatgggc
cgtgcccctcctgacttcctgaacatgaccgcagacatgaacacggaggtggatgctctg
gacccaagcattatggattttgcattgcaaggtaacatatgggaggaaatgaaagatgac
agcttcagccttgacaccctgggtgccttcagcaactctcccctgcacctctcagactgt
gacctgggcactcctggcctcacccccatttccagtggcagcgatcactccttgtcagac
tttcaggtcacaggcctttataccacttacacctccgtggacaacatagcagcagctcag
tacatgaaccctcaaggcaacaagcccatcgctctgctctaa

DBGET integrated database retrieval system