KEGG   Gallus gallus (chicken): 416918
Entry
416918            CDS       T01006                                 

Gene name
XBP1
Definition
(RefSeq) X-box-binding protein 1
  KO
K09027  X box-binding protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    416918 (XBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    416918 (XBP1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    416918 (XBP1)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf YabA CASP_C NRBF2 Fez1 KASH_CCD DUF4201 DivIC TSNAXIP1_N LCD1 JIP_LZII
Other DBs
NCBI-GeneID: 416918
NCBI-ProteinID: NP_001006192
CGNC: 4325
Ensembl: ENSGALG00000005796
UniProt: Q5ZL88
Position
15
AA seq 255 aa
MAALRGAPRLLLFPSDAAESAAGRRLSVVLPAGAAPDPAEAPPPARKRQRLTHLTPEEKA
LRRKLKNRVAAQSARDRKKARMTELEQQVVELEEENQRLLRENQRLREQTGSLSLENQEL
RCRLGLDALKTEPECESTDVKESQVDDIRLVTGSAESAALRLRVPLQQVQAQLSPFLTTS
TWILMAVTLQILSLISCSAFWTVWTQKCFSNVLIQNHPAWKSWRKRCVEKQIPYRPPPLP
LWGPHQLSWRPLMNS
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcggcgctgcgcggagccccgcggctgctcctttttccgagtgatgcggccgagtcc
gctgccggccgccgtctgtccgtcgtgctgcccgcgggggcggctcccgaccccgcggag
gctcctccgccggcccgcaagcggcagcgcctcacccacttgacccccgaggagaaggcg
ctgcgcaggaagctgaagaaccgcgtggcggctcagagcgcccgcgacaggaagaaggcg
cggatgacggagttggagcagcaggtggtggagctggaggaggagaaccaacggctgctg
cgggagaaccaacggctgcgggagcagacgggcagcctctccctggagaaccaggagctc
cgctgccgcctgggcttggacgctttgaagacagagccggagtgcgagtctacggatgtg
aaggaatcccaggtggatgacatcaggttggtgaccgggtccgctgagtccgcagcactc
agactacgtgttcctctgcagcaggtgcaggcccagctgtcaccattcctgacaacctcc
acatggattctgatggcagtgactcttcagattctgagtctgatctcctgttcggctttc
tggacagtctggacccagaaatgtttctcaaatgtgctgattcagaatcatccagcctgg
aaaagctggaggaagagatgtgtggagaaacaaattccataccgacctccccctctccct
ctctggggtccccatcagctaagctggaggccattaatgaactcataa

DBGET integrated database retrieval system