KEGG   Gallus gallus (chicken): 416979
Entry
416979            CDS       T01006                                 

Gene name
MSI1
Definition
(RefSeq) RNA-binding protein Musashi homolog 1 isoform X5
  KO
K14411  RNA-binding protein Musashi
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    416979 (MSI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    416979 (MSI1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     416979 (MSI1)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 416979
NCBI-ProteinID: XP_015130888
CGNC: 5460
Ensembl: ENSGALG00000007227
Position
15
AA seq 367 aa
MQKKSYLLHWQNFRMMNPSFLQTCAGICHCKMFIGGLSWQTTQEGLREYFSQFGEVKECL
VMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKK
IFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIH
FHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQAATYASR
SYTGIAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTVLLP
PVGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIAT
AFTNGYH
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcagaagaagtcttacctgctgcactggcagaatttcaggatgatgaacccctccttt
ctccagacctgtgcaggaatctgccactgcaaaatgttcatcgggggactgagctggcag
accacgcaagagggcctgcgggagtacttcagccagttcggcgaggtgaaagagtgcctg
gtgatgcgggacccgctgacaaagagatccaggggcttcgggttcgtcacgttcatggac
caggctggcgtcgacaaggttctggcccaatccagacatgaactggactccaagacgatt
gacccgaaggtagcgttcccccgccgagcacagcccaagatggtgacccgaacgaagaag
atatttgtgggtggtctgtcagtgaacactactgtggaggatgtgaaacagtatttcgag
cagtttgggaaggtggatgatgcgatgctgatgtttgacaagacaaccaaccgacaccga
gggtttggatttgtcacatttgaaagtgaagacattgtggaaaaagtatgtgaaatccac
ttccatgagattaacaacaaaatggtggagtgcaaaaaagcccagcccaaggaggtgatg
tccccaacaggctcagcacgagggcggtcccgagtcatgccttacgggatggatgccttc
atgctcgggatcggcatgctgggttatccaggcttccaagctgccacctacgcgagtcga
agttacactggcattgcacctggttacacttaccagttccctgagttccgtgtagagcgg
acccctctcccgagtgcccccgtcctccctgagctcacagcaattcccctcactgcgtat
ggaccaatggcagcagcagcagctgcggcagctgtggtgcgagggacagttttgctgcct
cctgtaggttccacccccagtcgcaccggtggatttctgggcaccaccagccctgggccg
atggcagagctttatggagccgccaaccaggactcaggggttagcagttacatcagcgct
gccagtccagccccaagcactggctttggccacagcctagggggtcccttgattgcaaca
gcttttaccaatgggtatcactga

DBGET integrated database retrieval system