KEGG   Gallus gallus (chicken): 416990
Entry
416990            CDS       T01006                                 

Gene name
PEBP1
Definition
(RefSeq) phosphatidylethanolamine-binding protein 1
  KO
K06910  phosphatidylethanolamine-binding protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    416990 (PEBP1)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I51: IC family
   416990 (PEBP1)
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 416990
NCBI-ProteinID: NP_001185571
CGNC: 5589
Ensembl: ENSGALG00000007403
Position
15
AA seq 187 aa
MPVELGLWDGPLSLSEVEQKPAHPLRVKYGSVEIDELGKVLTPTQVQHRPTSIEWDGCDP
QKLYTLVLTDPDAPSRKDPKFREWHHFLVTNMKGNDVGSGTVLSDYVGSGPPKGTGLHRY
VWLVYEQPKQLTCNEPILSNRSGDKRGKFKVAAFRSKYGLGVPVAGTCYQAEWDDYVPKL
YEQLSGK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgccggtggagctggggctgtgggacgggccgctgagcctgagcgaggtggagcagaaa
cccgcgcacccgctgcgcgtcaagtatggctccgtggagatagacgagctgggcaaggtg
ctcacgcctacgcaggtgcagcaccgacccaccagcatcgagtgggacggctgcgacccc
cagaagctctacacgctggtgctcaccgaccccgacgcgcccagtaggaaggatccgaag
ttcagagaatggcatcacttcctggtgaccaacatgaaaggtaacgatgtggggagcggg
accgtgctgtcagactacgtgggctcggggccccctaaaggaacagggctgcaccgctac
gtgtggctggtgtacgagcagccaaagcagctgacctgcaatgagcccatcctgtccaat
cgctctggtgacaaacgagggaagttcaaggtagcagctttccgcagcaagtatgggctg
ggggtgccggtggctggcacttgctaccaggcagagtgggatgactatgtgccgaaactc
tatgagcagctgtctgggaagtag

DBGET integrated database retrieval system