KEGG   Gallus gallus (chicken): 417001
Entry
417001            CDS       T01006                                 

Gene name
RTN4R
Definition
(RefSeq) reticulon-4 receptor
  KO
K16659  reticulon-4 receptor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    417001 (RTN4R)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Receptors
  417001 (RTN4R)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 417001
NCBI-ProteinID: XP_415292
CGNC: 50402
Ensembl: ENSGALG00000007732
UniProt: F1NRZ3
Position
15
AA seq 483 aa
MKRAIAEGSKLLILVLCLNIQSEVESCPGACVCYSEPKITISCQQQGLTAIPTEIPIQSQ
RIFLHNNKITLVRSTSFTSCRNMTILWIHSNNISLIEPGAFYGLNKLEELDLSDNTNLKS
INPVTFRGLVHLHTLHLDRCGLMELSTGLFRGLFSLQYLYLQDNNLQNLLDDTFIDLANL
TYLFLHGNKIKSLSENVFRGLINLDRLLLHQNRVSLVHRRSFHDLGKVMTLYLFNNNLTV
LTGETMAPLVSLQYLRLNGNQWICDCQARSLWNWFKQFKGSSSELECHLPPHLAGRDLKR
LQSSDLEGCIDSFNQIRTSVFSTKTRSGKLATGSPPLSSHDGSMKCCQPEMDKSFIYEAK
GKAGPSSHSSRPSSNNPLKDKENMSKTKYVETDPSKNGSNKQINDSPFGTFPSIVDPPLT
KLRPEFLEPIEPSTVPTKKRQGCSKKNKSKAQCRLTQQGNSSTLQLSLSLLIPPLVWSLL
LLC
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagagggcgatagctgaaggaagcaaactgctgattttggtgctttgcttgaacatc
cagtcagaagtggagtcttgccctggagcgtgtgtgtgctacagcgaaccgaagatcaca
ataagttgtcagcagcaaggactgacagcaatccccacggagatacccatccagagccag
cgcatcttcttgcacaacaacaagataacccttgtgaggtccaccagcttcacgtcttgt
cgcaacatgacaattctttggatccactccaacaacatcagcctcattgagcctggggcc
ttctacggactcaacaaactggaggagctggatctcagtgacaacacgaacctgaagtct
atcaatcctgtcactttccgtggtcttgttcacctccacaccttacatctggaccgctgt
gggctcatggagctctccacggggctttttcgagggttgttttccttgcaatatctctac
cttcaggataataacctgcagaacctgctggatgacaccttcatagacctggcgaacctc
acctacctgtttttgcacggtaacaaaatcaagagcttatcagagaacgtctttcgcggg
ttaatcaacctcgaccggctgcttctgcaccagaacagagtcagcctggtccaccgccgg
tcttttcacgaccttgggaaagtgatgaccttgtacctgtttaacaacaacctgaccgtg
ctcacaggggaaaccatggcacccctggtgtccctccagtacctgcgcttaaatggcaac
cagtggatctgtgactgccaggctcggtctctctggaattggtttaagcagtttaaaggg
tcgtcttcggagctggagtgccaccttcccccacacttggcagggagagacctcaaaagg
ctgcagagctctgacttggagggatgcatcgactctttcaatcagattcgaacgagcgtt
tttagcactaagaccagatctggtaagctggccaccgggagtccccctctcagctcccat
gatggctccatgaagtgctgccagccagaaatggataaatcttttatatacgaagctaaa
ggcaaggcaggcccttcttcccacagcagccggccgtcctccaacaaccctctcaaggat
aaggagaacatgtccaaaaccaagtacgttgagacggacccttccaaaaatggcagcaac
aagcagataaatgattccccttttgggaccttccccagcattgtagaccctccattgacc
aagttgagaccagagtttctagagcctattgaaccttccacagtcccaaccaaaaagagg
cagggctgctctaaaaagaacaaatcaaaagcccagtgccgcctcacccagcaaggaaac
agctccacgttacagctcagcctaagccttttgatcccccccttggtgtggagcttactg
ttactctgctaa

DBGET integrated database retrieval system