KEGG   Gallus gallus (chicken): 417035
Entry
417035            CDS       T01006                                 

Gene name
BG8
Definition
(RefSeq) MHC B-G antigen isoform 2 precursor
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig Ig_2 Ig_6 HemY_N
Other DBs
NCBI-GeneID: 417035
NCBI-ProteinID: NP_001025841
CGNC: 50413
UniProt: Q31608
Position
16
AA seq 397 aa
MAFTSGCNHPSFTLPWRTLLPYLVALHLLQPGSAQITVVAPSLRVTAIVGQDVVLRCHLS
PCKDVRNSDIRWIQQRSSRLVHHYRNGVDLGQMEEYKGRTELLRDGLSDGNLDLRITAVT
SSDSGSYSCAVQDGDAYAEAVVNLEVSDPFSMIILYWTVALAVIITLLVGSFVVNVFLHR
KKVAQSRELKRKDAELVEKAAALERKDAELAEQAAQSKQRDAMLDKHVLKLEEKTDEVEN
WNSVLKKDSEEMGYGFGDLKKLAAELEKHSEEMGTRDLKLERLAAKLEHQTKELEKQHSQ
FQRHFQNMYLSAGKQKKMVTKLEEHCEWMVRRNVKLEIPAVKVGQQAKESEEQKSELKEH
HEETGQQAKESEKQKSELKERHEEMEQTEAVVVETEE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggccttcacatcgggctgcaaccaccccagtttcaccctcccctggaggaccctcctg
ccttatctcgtggctctgcacctcctccagccgggatcagcccagatcacggtggtggca
ccgagcctccgtgtcactgccatcgtgggacaggatgttgtgctgcgctgccacttgtcc
ccatgcaaggatgttcggaattcagacatcagatggatccagcagcggtcctctcggctt
gtgcaccactaccgaaatggagtggacctggggcagatggaggaatataaagggagaaca
gaactgctcagggatggtctctctgatggaaacctggatttgcgcatcactgctgtgacc
tcctctgatagtggctcctacagctgtgctgtgcaagatggtgatgcctatgcagaagct
gtggtgaacctggaggtgtcagaccccttttctatgatcatcctttactggacagtggct
ctggctgtgatcatcacacttctggttgggtcatttgtcgtcaatgtttttctccataga
aagaaagtggcacagagcagagagctgaagagaaaagatgcagagttggtggagaaagct
gcagcattggagagaaaagatgcagagttggcggaacaagcagcgcaatcgaagcaaaga
gatgcaatgttggacaaacacgttctaaaactggaggaaaagacagacgaagtggagaat
tggaattcagtgctgaaaaaagacagtgaagagatgggttatggctttggagatctgaag
aaactggctgcagaactggagaaacactctgaagagatggggacaagggatttaaagttg
gagcgactagctgccaaactggaacatcaaactaaagaattggagaaacagcattcacag
ttccagagacactttcagaatatgtatttaagtgctggaaaacagaagaaaatggttaca
aaactggaggaacactgtgaatggatggtgagaaggaatgtaaagttggagataccagct
gtaaaagtggggcaacaagctaaagaatcagaggaacagaaatcggagctgaaggagcac
catgaggagacggggcaacaagctaaagaatcagagaaacagaaatcggagctgaaggag
cgccatgaggagatggaacaaactgaagcagtggtggtagaaactgaagaatag

DBGET integrated database retrieval system