KEGG   Gallus gallus (chicken): 417039Help
Entry
417039            CDS       T01006                                 

Gene name
IL4I1
Definition
(RefSeq) L-amino-acid oxidase precursor
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00250  Alanine, aspartate and glutamate metabolism
gga00270  Cysteine and methionine metabolism
gga00280  Valine, leucine and isoleucine degradation
gga00350  Tyrosine metabolism
gga00360  Phenylalanine metabolism
gga00380  Tryptophan metabolism
gga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gga01100  Metabolic pathways
Module
gga_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    417039 (IL4I1)
   00270 Cysteine and methionine metabolism
    417039 (IL4I1)
   00280 Valine, leucine and isoleucine degradation
    417039 (IL4I1)
   00350 Tyrosine metabolism
    417039 (IL4I1)
   00360 Phenylalanine metabolism
    417039 (IL4I1)
   00380 Tryptophan metabolism
    417039 (IL4I1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    417039 (IL4I1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     417039 (IL4I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 AlaDh_PNT_C DAO Pyr_redox_2 Pyr_redox Thi4 FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 Pyr_redox_3 MCRA 3HCDH_N Trp_halogenase GIDA DUF1188 FMO-like TrkA_N NAD_Gly3P_dh_N ApbA
Motif
Other DBs
NCBI-GeneID: 417039
NCBI-ProteinID: NP_001092821
CGNC: 50416
Ensembl: ENSGALG00000000081
UniProt: F1NM87
Position
16
AA seq 523 aa AA seqDB search
MAAMVLFQMLLLLGLASAKRFSCFPEYCLHDKDYEELLSIVKYGLEPTTRPSNVVIVGAG
ISGLTAAKLLRDAGHKVTILEISNRVGGRIRTYREKDWYVELGAMRLPSKHRLVREFIRQ
FDLKLNPFRQTDDNAWYFVNGIRARVAEVNRNPDILNYTLRPSERGKSASQLYREALQSA
VKEFQTMNCKEYLAKHDSFSTKEYLIKVGNLSRGAVQMIGDLLNEDSGFYLSFLASLWDF
DIFSNGESFDEITGGFDQLPKAFHKALPGVIKFNCTVEKIMTKGGKVRVFYRAPDTLAPS
IVTADYVLVTSSAKATRHIQFFPPLSPAKNEALRSIHYASASKIALACTEKFWEKDGIQG
GQSITDRPSRFIYYPSHNFSSGVGVILASYTWNDDAEFLIPLADEKYLDVVLQDLSDIHR
VSKSYLQYTCDRYVIQKWQLDRHSLGAFAAFTPYQFTDYSQALFEHEGRVHFAGEHTAQP
HAWIDTSMKAAVRAASNIHDDSETRNLSPNHVHLESFVEKGEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatggttctcttccaaatgctcctcctactgggactcgccagcgccaagagg
ttctcgtgcttccctgagtattgcctccatgacaaagactacgaagagctgctgagtatt
gtgaaatatgggctggagcccacgacgcgtccatcgaatgtggtcatcgttggggctggg
atcagcgggctgacagcagccaaactgctccgagacgccggccataaggtcacgattctg
gaaatcagcaatagggttggtgggaggatcaggacctaccgggagaaggactggtatgtg
gagctgggagccatgcgcctgccgagcaagcacaggctggtgcgtgagtttataaggcag
tttgacctgaagctcaacccgttccgccagacagatgacaatgcctggtacttcgtgaac
ggcatccgagcgagagtggcagaagtgaacagaaaccccgacatcctgaattacaccctc
aggccgtcagagaggggcaaaagtgccagccagctctacagggaagccctgcagtcggct
gtcaaggagttccagaccatgaactgcaaggagtatctggctaaacacgactccttctcc
accaaggaatatctgattaaagtcgggaatctgagccgaggagctgtgcagatgatcgga
gatttgctgaacgaggactcggggttttacctgtccttccttgcctcgctgtgggatttt
gatatcttctctaacggggagagctttgacgaaatcacgggaggtttcgaccagctgccc
aaagccttccacaaagcactgccgggcgtcatcaaattcaattgcacggtggagaaaatc
atgacgaagggagggaaggtccgggtgttctaccgcgctccggacaccctcgcccccagc
atagtgaccgcagattacgtcctggtcacctcctcggccaaagccacgaggcacatccag
ttcttcccacctctctcccctgccaaaaacgaggctctccgctccatccactacgcgagc
gcttccaaaatcgccttggcatgcacggagaagttctgggagaaggacggcattcaagga
gggcaatccataaccgaccgcccctccaggtttatctactaccccagccacaacttctcc
agtggggtcggggtcatcttggcctcctacacctggaacgacgacgctgagttcctcata
cccttagcggatgagaaatacttggacgtggttctccaagacttgtcggacatccaccgg
gtgagcaagagttacctgcagtacacctgcgaccgctacgtgatacagaagtggcagctg
gacaggcattccctgggagccttcgctgccttcacgccgtatcagttcaccgattactcc
caggcgctctttgagcacgaggggagggtgcactttgcaggggagcacaccgcccagcct
cacgcatggatcgacacctccatgaaggctgcggtgagggcagcgagcaacatccacgac
gacagcgaaacccgaaatctcagccctaaccacgtacacctggagagcttcgtggagaag
ggagagctctga

DBGET integrated database retrieval system