KEGG   Gallus gallus (chicken): 417057
Entry
417057            CDS       T01006                                 

Gene name
MHCIA6
Definition
(RefSeq) class I histocompatibility antigen, F10 alpha chain
  KO
K06751  MHC class I antigen
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
gga04145  Phagosome
gga04218  Cellular senescence
gga04514  Cell adhesion molecules (CAMs)
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    417057 (MHCIA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    417057 (MHCIA6)
   04145 Phagosome
    417057 (MHCIA6)
  09143 Cell growth and death
   04218 Cellular senescence
    417057 (MHCIA6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    417057 (MHCIA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    417057 (MHCIA6)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
    417057 (MHCIA6)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   417057 (MHCIA6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:gga00537]
 Antigens
  417057 (MHCIA6)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 MHC_II_beta MHC_I_3
Other DBs
NCBI-GeneID: 417057
NCBI-ProteinID: XP_025011669
CGNC: 50426
Position
16
AA seq 326 aa
MAPSEAVVLGLLLGALGMVACGSHSLRYFKTRMTDPGPGMPQFVIVGYVDGELFGKYDSK
SRWVHPIAEMLPQEDREHWDTQTQKARDVELVFCGFLGRLQVHYNKSGGSHTLQKMFGCD
ILEDGSIRGYDQYAFDGRDFLAFDMDTMTFTAADPVAEITKRRWEEEGTYAERWKHELGT
VCVQNLRRYLEHGKVALKRRERPKVRVWGKEADGILTLSCRAYGFYPRPIAISWMKDGMV
RDQETHWGGIMPNRDGTYYASAVINVLPEDGDKYQCRVEHASLPQPGLFLWEPLPNLIPI
VAGAVVAIVAVIAAVVRLVVWKSKSG
NT seq 981 nt   +upstreamnt  +downstreamnt
atggctccgagcgaggcggtggtgctggggctgctgctgggcgccctgggcatggtggcg
tgtgggtcgcactctctgcgctacttcaagaccaggatgacggatcccggccccgggatg
ccgcagttcgtgatcgtcgggtacgtggatggcgaactcttcgggaagtacgacagtaag
agccgatgggtgcaccccatcgcagagatgctgccgcaggaggaccgggagcactgggac
acacagacccagaaggcgcgggacgttgagctggttttctgcgggttcctgggcaggctg
caggtacactacaacaaaagtggagggtctcacacgctgcagaagatgtttggctgtgac
atcctggaggacggcagcatccgagggtacgatcagtatgcatttgatgggagggacttc
ctcgcctttgatatggacacaatgacgttcactgcggcagacccagtggcagaaatcacc
aagaggagatgggaggaggaagggacgtatgctgagagatggaagcatgagctggggacg
gtctgcgttcagaacttgaggagatacctggagcatgggaaggtggcactgaaaaggaga
gagcggcccaaggtgcgagtgtgggggaaggaggccgacgggatcctgactttatcctgc
cgcgcttatggcttctacccgcggcccatcgccatcagctggatgaaggacggcatggtc
cgggaccaggagacccactgggggggcatcatgcccaatagggatggcacctactatgcc
tcggctgtcatcaatgtgctgccagaagatggggacaagtaccagtgccgtgtggagcac
gccagcctgccccagcccggcctctttttgtgggaaccgctgcccaacctgatccccatt
gtggccggggcggtcgttgccattgtggctgtcatcgctgctgtcgttagattggtggtg
tggaagagcaagtcagggtag

DBGET integrated database retrieval system