KEGG   Gallus gallus (chicken): 417108Help
Entry
417108            CDS       T01006                                 

Gene name
ZBTB6
Definition
(RefSeq) zinc finger and BTB domain-containing protein 6
  KO
K10493  zinc finger and BTB domain-containing protein 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    417108 (ZBTB6)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     417108 (ZBTB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met zf-C2H2_2 zf-C2H2_11 zf-LYAR Sprouty zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 417108
NCBI-ProteinID: NP_001264570
CGNC: 14627
Ensembl: ENSGALG00000021570
Position
17
AA seq 427 aa AA seqDB search
MAADSEVLHFQFEQQGDAVLQKMNLLRQQNLFCDVSIYINDTEFHGHKVIFAACSTFMRD
QFLLNQSRQVRITILQSAEVGRKLLLSCYTGALEVKKKELLKYLTAASYLQMVHIVEKCS
EALSKYLEIDASMENSSQAAEKCHSSDTELRSKDDVSDKDCEIIEIYEDSPVNLEFSVKQ
EKGDNLQPAAQSLVSERKDTGTPEISTVEIGYKDDEICIFRMDSMNVPNVENDHFPQPCT
SSKTNLYFPETQHSLINSTVESRNTEMSGAHAQAFVTDNPEGTSTQMNGFQNLDDSDNLW
RNQCPKCPRGFLHLENYLRHLKMHKLFLCLQCGKTFTQKKNLNRHIRGHMGIRPFQCMVC
LKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSSEKPNLNAIT
KIEIDCD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggactcggaggtgctgcacttccagttcgagcagcagggagatgcggtgctg
cagaaaatgaacctcctgcggcagcagaacctcttctgcgacgtctccatttacatcaac
gacaccgaattccacgggcacaaggtgatctttgctgcctgctccacgttcatgagggat
cagttcctgctcaaccagtccaggcaggtgcgaatcaccatcctgcagagcgccgaggtg
ggcaggaagctgctgctctcctgttacacgggtgcgctggaggtcaagaagaaggagctc
ctgaagtacctgactgccgccagctacctccagatggtccacattgtggaaaagtgcagc
gaggcgctttcaaaatacctggaaatcgacgcttccatggagaatagcagccaggctgca
gagaagtgccattcctctgacactgaactgaggagcaaggacgatgtttcggataaggac
tgtgaaataattgagatttatgaagatagcccagttaatttagagttctctgttaaacag
gagaagggggataacttgcagcctgcggcacagagtttggtctcagaaagaaaggacaca
gggaccccggaaatatcaacggttgaaataggatataaggatgatgagatatgtatcttc
agaatggattctatgaacgtacctaatgtggaaaatgatcattttcctcagccttgcacc
tcctctaaaacaaacttatatttcccagaaacccagcactccttgataaactctacagtt
gaaagcagaaatacagaaatgtcaggagctcacgctcaggcttttgtcactgacaatcca
gaggggacttcgactcagatgaacgggtttcaaaatctggatgattctgataacttgtgg
cggaaccaatgtccgaagtgtccaagaggatttctgcatcttgagaactatcttagacac
ctaaaaatgcacaagcttttcttgtgtttgcagtgtggtaaaacatttacacaaaaaaag
aatctcaacagacacatccggggccatatgggtatccgcccattccaatgcatggtgtgc
ttgaagacgttcactgccaaaagtactctacaggatcacttgaacatacacagcggtgac
aggccctacaagtgtcattgctgtgacatggacttcaaacacaagtctgctcttaaaaag
cacctcacatctgttcatgggaggagtagcagcgaaaaaccaaacctgaatgctattaca
aaaattgaaatagactgtgattaa

DBGET integrated database retrieval system