KEGG   Gallus gallus (chicken): 417143
Entry
417143            CDS       T01006                                 
Symbol
RXRA
Name
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga03320  PPAR signaling pathway
gga04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    417143 (RXRA)
   03320 PPAR signaling pathway
    417143 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    417143 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:gga03310]
    417143 (RXRA)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    417143 (RXRA)
Nuclear receptors [BR:gga03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   417143 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 417143
NCBI-ProteinID: XP_003642339
CGNC: 1890
UniProt: A0A1D5P2B5
Position
17:7577180..7655316
AA seq 467 aa
MDTKHFLPLDFSNQVNSTSLNSPTSRGPMATPSLHPSIGPGIGSSLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPSTPSLGFGTSSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYIEANMGLTPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacaccaaacacttcctgccactggatttctcaaaccaagtcaattccacatccctg
aactccccgacgagccgaggccccatggccaccccatccctgcacccgtccatcgggccg
ggcatcggctcctcgctgggctccccgggccagctgcactcacccatcagcaccctgagc
tcacccatcaatggcatggggccacccttctccgtcatcagctcccccatgggcccacac
tcgatgtctgtcccctccacgcccagcctgggattcggcaccagcagcccacagctcaac
tcacccatgaaccccgtcagcagctcagaagacatcaagccacccctggggctcaatgga
gtcctcaaagtgccagcacatccctcaggaacaatggcctccttcaccaagcacatatgt
gccatctgcggggacagatcttcaggtaaacattatggggtgtacagctgcgagggctgc
aaaggcttcttcaaacgcacggtgaggaaggacctgacctacacctgccgtgacaacaag
gactgcttgatcgacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgt
cttgccatggggatgaagagggaagctgtgcaggaggagaggcagcgggggaaggaccgc
aacgagaacgaggtggagtccacaagtagcgccaacgaggacatgcccgtggagaagatc
ctggaagcagaactcgctgtggagccaaagacagagacgtacattgaggcaaacatgggc
ctgacgccgagctcgcccaacgacccggtgacgaacatttgccaggcggccgacaagcag
ctcttcaccttggtggagtgggccaagaggatcccccatttctcagagctgcccctggat
gaccaggtcatcctgctgcgagcagggtggaatgagctcctcatcgcctccttctcccac
cgctccatagctgtgaaggatgggatcctgctggccacggggctgcacgtgcaccgcaac
agcgcgcacagcgccggtgtcggggccatctttgacagagtactgacagaactcgtgtcg
aagatgcgagacatgcagatggacaagacagagctgggctgcctgcgagccatcgtcctc
ttcaaccccgactcaaaaggtctctccaacccggctgaagtggaggcattacgggagaag
gtgtacgcatcgctggaggcgtattgcaagcacaaataccccgaccagcccgggaggttc
gccaagctcctgctccgtctgccagccctacggtccatcggcctcaaatgcctggagcac
ctcttcttcttcaagctaataggcgacacgccgatcgacaccttcttgatggaaatgctg
gaagcaccccatcaaatgacttag

DBGET integrated database retrieval system