KEGG   Gallus gallus (chicken): 417152
Entry
417152            CDS       T01006                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    417152 (ADAMTS13)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     417152 (ADAMTS13)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   417152 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 Reprolysin_5 Reprolysin_3 Reprolysin_2 Peptidase_M10 Peptidase_M66 TSP1_CCN
Other DBs
NCBI-GeneID: 417152
NCBI-ProteinID: XP_024997174
CGNC: 16490
Ensembl: ENSGALG00000033597
Position
17
AA seq 963 aa
MGAKTARAGHFAPRLQKRADGAVKHLELMVVAGPDVYMYHQEDTERYILTNLNIGAELLR
DASLGAHFRVHLMQMLVLREPEVNVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVL
YVTRFDLQLPDGNKELRGVTRLGGVCSSSWSCVITQDTGFDLGVTIAHEIGHSLGIPHDG
EGNQCSSSGFIMGSAGNRNSVDLIWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGWKP
GLYYGADEQCKIAFGSVATACTFADSNVDICKVLSCHVQPGDKSSCTRLLVPLLDGTECG
VNKWCSKGQCSSLTELNPMAVVHGQWSSWSPFSXCSRSCGGGVQIRQRFCNNPRPAFGGK
ECQGASIQAEMCNTQACLMTQLDFMAEQCAATNLKPLYLTVGVPSFYTWTSAVGFAKGDT
QCKHMCRTIEDEFMVSREDSFIDGTRCEPDNSEDGTFHLCVAGSCRAFGCDGQMNSKRAM
DSCKVCGGDNTTCMEVSGSYTEGKAKEYVTFLSLPYNATSVHVINQRPLFTHLAVKVKGE
YVVAGKGKISLNVTYPSVLEDRQIEYKVFLTNHNLPSLEEIHVDGPIQEEIEIQVYRRYA
KEYGDATNPDITFSYFVPKENLTYRWIPHEGPCSVTCGGGTQLVNYVCFDQMKNEITENQ
LCLGLLQPLPGYEPCAVEPCPYRWKISQTDECSAVCGSGVAQQNLTCVQFHNGSETVVDD
SLCSAREKPLSIVPCVVNVCPLGWDREEDMDLLRTLELPGHIQLENQSIYVWSPLPGECS
VSCGRGKTQIQYVCVAFDTKEKTQEENCHPVAKPESRLEDCNLSPCPPRWHYKMGSCSVS
CGGGVMQKVLYCARETREKEEEIVADVQCDGLPRPEEQEPCNLEPCPPRWKVTPGGPCSS
SCGLGLSVQLVTCVQIQQGKEILLEQHSCPVSEKPLTTIPCVIRMCSYEWSFSEWTEVMK
LKN
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgggggcaaaaacagcaagagcagggcactttgctcctcgcctacaaaagagggctgat
ggagctgtcaaacatctggagctgatggttgtagcaggtcctgatgtttacatgtaccac
caggaggacacggagcgatatattcttaccaacctgaacattggggcagaactgctgcga
gatgcctcactgggtgctcatttcagggttcatttgatgcaaatgcttgttttgagggag
ccagaggtgaatgtgaacatcacaacaaatatcacctcctcgctgatcagtgtttgtgag
tggagcaagaaggtcaacccccagaatgactctgatccccagcatgctgacatcgtcctg
tatgtgaccaggtttgacctgcagttacccgatgggaacaaggagctacgtggagtgact
cggttaggtggggtctgctcctcctcctggagctgtgttattacccaggacactggcttt
gacttgggagtcaccatagcccatgagattgggcacagtcttggcatcccccatgatggt
gaggggaatcagtgcagcagcagtggtttcatcatgggctcagcaggaaaccgtaatagt
gttgacctcatctggtcacagtgtagccgagaagaattcctggcctttgtcagcacaggc
caaacaaactgcttaaatgacctgccggacatggacggcagcatccctggatggaagcct
ggcttgtactatggagcagatgagcaatgtaaaatagcctttgggagtgttgcaactgcg
tgcacctttgctgacagcaatgttgatatatgtaaagttctctcatgccatgtacaacca
ggagataaatccagctgtactcggcttcttgttcccctcttagatggtactgagtgtggc
gtcaataagtggtgctccaagggacagtgcagctctctgacagaactaaaccccatggct
gtagtccatgggcagtggtccagctggagcccattttctncctgctcccgcagctgtgga
ggtggagttcagataaggcagcggttctgtaataaccccaggcctgcttttggagggaag
gaatgccagggtgccagcattcaagcagagatgtgcaatactcaggcctgtctgatgacc
cagcttgactttatggctgaacagtgtgcagcaacaaatttaaagccactgtatctcact
gtaggagtgccatccttttacacctggacttctgctgttggctttgccaaaggggacacg
cagtgcaagcacatgtgcaggaccattgaggatgaattcatggtaagccgtgaggacagt
ttcatagatggaaccagatgtgagcctgataactctgaagatgggactttccatctgtgt
gtagcgggaagctgcagagcattcgggtgtgatggccagatgaactccaagagggcaatg
gactcttgcaaggtctgtgggggtgataataccacctgtatggaagtgagtggatcttac
acagaaggaaaagctaaagagtatgttacgtttttgtccctgccttataatgccacctca
gtccatgttatcaatcagaggccgctcttcactcatttggctgtgaaggttaaaggtgaa
tatgtggttgctggaaagggaaaaatctcactgaatgtcacctatccctcagttctggag
gacagacagattgaatacaaagtgtttctcaccaaccacaacctcccaagcctggaggaa
atccatgtggatggaccaatccaagaagaaattgaaatacaggtttatagaaggtatgca
aaagaatatggcgatgccaccaacccagacatcaccttcagctactttgtgccaaaagag
aatctgacgtataggtggattcctcacgaggggccgtgttcagtgacctgtggaggaggt
acacaacttgtgaactatgtgtgctttgatcagatgaagaatgaaataacagaaaatcag
ctgtgtctgggactcctacaaccccttccagggtatgaaccctgtgccgtggaaccatgc
ccatacaggtggaagatatctcagacagatgaatgctctgctgtttgtggaagcggcgtt
gcccagcagaatctgacctgtgttcagtttcataatggatcggagactgttgtggatgac
agcttatgttctgcacgagaaaaaccactctccattgtgccgtgtgtagttaatgtctgc
cctttgggatgggacagagaggaagacatggacttgcttcggactctagagttacctgga
catatccaactggaaaatcagagtatttatgtctggagccctctacctggagaatgttca
gtgtcctgtggtagaggtaagactcagatacagtatgtatgtgtggcttttgacactaaa
gaaaaaacccaagaagaaaactgtcatccagtggcaaagccggagagcaggttggaagac
tgcaatctcagtccctgcccaccaaggtggcattacaaaatgggctcatgcagtgtaagc
tgtggaggaggtgtgatgcagaaggtcctctactgtgcaagggaaaccagagagaaggaa
gaagaaattgtggcagatgtccagtgtgatggtttgcctcgtccagaggagcaggaaccg
tgtaacttggagccatgccccccaagatggaaggtaaccccgggtggcccctgttcctcc
agctgtgggcttggcttatctgttcagctggtcacctgtgtgcagattcagcaaggcaaa
gagattttgctggagcagcattcatgtcctgtgtcagagaagccccttactaccattccc
tgtgtcatccgaatgtgttcttatgaatggagcttcagtgaatggacagaggtgatgaaa
ctaaagaactga

DBGET integrated database retrieval system