KEGG   Gallus gallus (chicken): 417216
Entry
417216            CDS       T01006                                 

Gene name
CIZ1
Definition
(RefSeq) cip1-interacting zinc finger protein isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-C2H2_jaz
Other DBs
NCBI-GeneID: 417216
NCBI-ProteinID: XP_015135040
CGNC: 66273
Ensembl: ENSGALG00000042325
Position
17
AA seq 740 aa
MFNQQQFQQQLLQLQHLLQQQQHHHHPPAQQGGRGLPPPPPPPQQQQMLSLRATNQPSLL
NANPMLQRALLMQQMQGNLRGFNMTAPALQQFFPQATRHSLLGPPPVGVSLKPTRLGFPN
LPFQRQNRMFRKDFQRVPDRKRELDAGSSSHMHGDEKIEFRGELRAGSEQNNSLSTEPRT
PAEAVLNTEPAAKRLKSVTEESALENAAGSKEELSTHVQADGTNNVKQYAAESLSKERKF
SEEPKAPEVLSSGGSLKVTIQQSSESRAISTTALKPGQWTCEMGTADASPESALKFYCYI
CKTNCCNQQNFQAHMAGIQHQQRLGEIQHMSNVCFVSLLPMVKEQKLLAEKDGETQQRWC
NTCQIHFTGDLIKHRRTQEHKLAKRSLRPFCTVCSRHFKTPRKFVEHMKSPEHKQKAKEV
RLGEKELGSPEDSEELITVDAVGCFEDDEEEEEEEEEEEGTGEGEDLDVVLVENEDSAAK
QTGLKEVSLEDYKGSEKYCPDTAYGLDFLVPVAGYLCRLCHKFYHSDSAARLAHCKSLMH
FENFQRYKVARHRATAAYPEAPLHSQGSGSQLLDDQKQPPATTEDSSKKTNANHGIDKEG
TELSALQEQALRSPEGKGKLATAVAESKSLASVTDVCGITVVEENLQESKSTATCPLPEE
SSAAGELLGHAVYEEEEANAARQGEGTDYCQDPGSGGGLGQKEASNVGQEAAAEPSSLAK
GEAASLTSAGCRRSSRRKPR
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgttcaaccagcagcagttccagcagcagctgctgcagctccagcacctcctccagcag
cagcagcaccaccaccaccccccggcgcagcagggaggccgtggtttgccgccgccgccg
ccaccaccacaacagcaacagatgctgagcttacgggcaacaaatcaaccatccctactc
aatgccaatcctatgcttcagcgggccttactcatgcaacagatgcaaggaaacctgcgt
ggatttaacatgacagccccagcactgcagcagttcttccctcaggctacgaggcattcc
ctcctagggccaccacctgttggggtctcattaaagccgactcgtttgggcttccccaac
cttcccttccagcggcagaaccggatgtttcgcaaggacttccagagggtccctgacagg
aagcgggagcttgatgcaggttcttcatctcacatgcacggtgatgagaaaatagaattt
agaggggaactgcgagcaggatcagagcagaacaactctctatccacagaaccaagaact
ccagcagaagctgtgttgaacactgagcctgcagcaaaaagactgaagagtgtgactgaa
gagtctgcattagagaatgcagcaggcagcaaggaagagttgagcacccatgtccaagct
gatggtacaaataatgtaaagcagtacgcagctgaaagtctctctaaagagaggaaattc
tctgaggaaccaaaggctcctgaggtgttgagctctggaggttcactgaaagtgactatc
cagcagagcagtgagagcagagctatcagtacaacagctctgaaaccagggcagtggacc
tgcgagatgggcacagctgatgccagccctgaatcagcccttaaattctactgttatatc
tgcaagaccaactgctgcaatcagcagaatttccaagcccacatggctggaattcagcac
cagcagcgacttggggagattcagcacatgagcaatgtttgttttgtttcactactgcct
atggtgaaggagcagaagttgctggcagagaaagatggagagacccagcagcggtggtgt
aacacttgtcagatacacttcacaggggatctgatcaaacatcgcaggacccaagaacac
aagctggccaaacgctcacttcgtcctttctgcactgtctgcagccgccatttcaagacc
cctcgcaagttcgtggagcatatgaagtcccctgagcataaacagaaagccaaagaggtg
agactgggagagaaggagttgggcagcccagaagattcagaggagttgatcacagtggat
gctgttggctgctttgaagatgatgaagaggaggaagaggaggaggaagaagaggaggga
actggtgagggggaagaccttgatgtagtgctggtagagaatgaggactctgctgccaag
cagactgggctgaaggaagtgtctttggaggattacaaaggaagtgagaagtattgtcca
gatacagcctatggcctggattttctggtccccgtcgcaggttacctctgcaggctgtgt
cacaaattctaccatagcgactctgctgcccggctcgcacactgcaagtccctgatgcat
tttgagaactttcagagatacaaggtagcaaggcatcgtgccacagctgcctatccggag
gctcccttgcattcccagggctccggctcccagttgctagatgatcagaaacagcctcct
gctacaacagaagatagcagcaagaagacgaatgccaatcacgggatagacaaggagggt
acagagctgtcagcactgcaggaacaagctttgaggtctccagagggtaagggcaagctg
gccaccgctgtagcagagagcaaaagcctagccagcgtgactgatgtgtgtggaatcacg
gttgtagaagaaaacctacaggagagcaaatccactgccacttgtccgctccccgaagag
agcagcgccgcaggcgagttgttgggacatgctgtgtatgaggaggaggaagccaatgca
gccaggcaaggggaaggcacagactactgccaggatccagggagcggaggggggttggga
cagaaagaggcatcaaatgtaggccaggaggcagcagcagagccctcctccctagccaaa
ggtgaggctgccagtcttacctctgctgggtgcagacgctcttctaggcgcaaacccaga
tag

DBGET integrated database retrieval system