KEGG   Gallus gallus (chicken): 417228Help
Entry
417228            CDS       T01006                                 

Gene name
FAM102A
Definition
(RefSeq) protein FAM102A
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: NT-C2 SMN
Motif
Other DBs
NCBI-GeneID: 417228
NCBI-ProteinID: NP_001186095
CGNC: 3774
Ensembl: ENSGALG00000005074
Position
17
AA seq 382 aa AA seqDB search
MAFLMKKKKFKFQTSFTLEELTAVPFVNGVLFCKIRLLDGGDFASLSTREEVQENCVRWK
KKFTFVCKMSANPATGLLDPCICRVSVRKELKGGKTYSKLGFADLNLAEFAGSGSTVRCC
LLEGYDTKNTRQDNSILKVTIGMSLLSGDPCFKTPPSTAKSITIPGQDSTLQLTCKGEGT
TSSNSSSATIGSLRQTKPRATILSSGVPEEPDQNLSSPEEVFHSGHSRNSSYASQQSKIS
GYSTEHSRSSSMSDLTHRRNTSTSSSASGGLSMTVECPEGERDHKLEKPPRPPRPALLLD
RPSRRKKDSVESHPTRVDDTRIDADDIVEKIMQSQDFTDVSNTEDSNLRLFVSRDGTTTL
SGIQLGNRVSSGVYEPVVIETH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctgatgaagaagaagaaattcaaatttcagacaagttttactctagaagag
ctgactgctgtcccctttgtgaatggggttctgttctgcaaaatcaggctgttagatgga
ggagactttgctagcttatctaccagagaagaagtccaggaaaattgtgtccgctggaaa
aagaaatttacctttgtgtgtaaaatgagtgccaacccagccacaggactcctggacccc
tgcatctgccgagtgtctgtccgtaaggagctgaagggcggaaaaacctactccaagctg
ggctttgctgatctgaatctggcagaatttgcaggctctggatccactgttcgttgctgc
ttgctggaaggatatgatactaagaacacgcgacaggacaactccatcctaaaggtcacg
attgggatgtccctgctctcaggggacccctgcttcaaaacgccgccttccaccgccaaa
tccatcaccataccagggcaggactctaccctgcagcttacctgcaagggtgagggaacc
acaagcagcaacagcagttcagccacaattggttctctgcgtcagaccaagccaagagca
accattctcagctcgggtgtccctgaagaaccagatcagaatctgtccagcccagaggaa
gtcttccactccgggcactcgcggaactccagctatgccagccagcagtccaagatctct
ggttacagcacggagcactcccgttcttctagtatgtctgacttgacccatcgccggaat
acctccaccagcagcagtgcatctggagggctgagtatgacagtggaatgccctgaggga
gagcgggaccacaaactagagaagccacctcgccctcccagaccagctcttctgctggac
agaccctcccggaggaaaaaggattcagtggagagtcacccaacccgagtggatgacacc
agaatcgatgcagatgatatagtggagaagataatgcagagtcaggacttcacagatgtc
agcaatactgaagacagtaacctgcggttgtttgtgagcagagatggaacaactacactg
agtggtattcagctgggaaacagggtctcatctggagtttacgagccagtggtgattgaa
acccactaa

DBGET integrated database retrieval system