KEGG   Gallus gallus (chicken): 417255
Entry
417255            CDS       T01006                                 

Gene name
TUBB4B
Definition
(RefSeq) tubulin beta-3 chain
  KO
K07375  tubulin beta
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04540  Gap junction
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    417255 (TUBB4B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    417255 (TUBB4B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    417255 (TUBB4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    417255 (TUBB4B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    417255 (TUBB4B)
   04147 Exosome [BR:gga04147]
    417255 (TUBB4B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     417255 (TUBB4B)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    417255 (TUBB4B)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   417255 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   417255 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   417255 (TUBB4B)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 417255
NCBI-ProteinID: NP_001074329
CGNC: 50466
Ensembl: ENSGALG00000008586
UniProt: F1NYB1
Position
17
AA seq 445 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEAE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacctgcaggccgggcagtgcggcaaccagatcggggccaagttc
tgggaggtgatcagcgacgagcacggcatcgacccgacgggcacctaccacggagacagc
gacctgcagctggagcgcatcaacgtgtactacaatgaggccacaggcggcaagtacgtg
ccccgcgccgtgctggtggacctggagcccggcaccatggactcggtgcgctcggggccc
ttcggccaaatattcaggccggacaacttcgtatttggtcagagcggagcaggaaacaac
tgggcaaagggccactatactgaaggtgctgaattagttgattccgtattagatgttgtg
agaaaggaggcagaaagctgtgattgcctgcagggctttcagctcactcactcgctgggg
ggtggcaccggctctggcatgggcactctgctcatcagcaaaattcgcgaagagtaccca
gaccggattatgaacaccttcagcgttgtgccctcccccaaagtctcagacactgtagta
gagccctacaacgccacgctgtcggtgcaccagctcgtggagaacacggatgaaacctac
tgtattgataacgaagctctgtatgacatatgcttcagaacactgaagttaactacgcca
acatacggtgatctgaaccatttagtgtcagccaccatgagcggtgtcaccacctgcctg
cgtttcccaggccagcttaatgccgacctgcggaagctggcggtgaatatggttcccttc
ccccgcctgcactttttcatgcctggctttgcccccctgacgagccgtggcagccagcag
taccgcgctctgaccgtcccggagctcacgcagcagatgtttgatgccaaaaacatgatg
gctgcgtgcgacccgcggcacggccgctacctgaccgtagctgctgttttcagaggccgt
atgtccatgaaagaggtagacgagcaaatgctgaacgtgcagaacaaaaacagcagttac
tttgtggaatggatccccaataacgttaaaacagcggtctgtgacattccacctcgtggc
ctgaaaatgtctgccacgttcattggtaacagcacagccatccaggagctgttcaaacgc
atttcagagcagttcacggctatgttccgccgcaaggctttcctgcactggtacacaggc
gagggcatggacgagatggaattcacagaggctgagagcaacatgaacgacctggtgtct
gagtatcagcagtaccaggacgctactgctgaggaggagggggagtttgaggaagaggct
gaggaggaggcagagtaa

DBGET integrated database retrieval system