KEGG   Gallus gallus (chicken): 417264
Entry
417264            CDS       T01006                                 

Symbol
RPL12
Name
(RefSeq) 60S ribosomal protein L12
  KO
K02870  large subunit ribosomal protein L12e
Organism
gga  Gallus gallus (chicken)
Pathway
gga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    417264 (RPL12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gga03011]
    417264 (RPL12)
Ribosome [BR:gga03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    417264 (RPL12)
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 417264
NCBI-ProteinID: NP_001264608
CGNC: 50469
Ensembl: ENSGALG00000008806
UniProt: E1BTG1
Position
17:1924850..1927248
AA seq 165 aa
MPPKFDPTEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGSVSFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCSIDGRHPHDIIDDINSGAIECPAS
NT seq 498 nt   +upstreamnt  +downstreamnt
atgccgcccaagttcgatccgaccgaggtgaaagtcgtgtatctgcgctgcaccggcggg
gaggtcggcgccacttccgccctggcccccaagatcggaccgctcgggctgtctcccaaa
aaggtcggtgatgacatcgccaaggccacgggggactggaaggggctgaggatcacggtg
aagctcaccatccagaacaggcaagcgcagatagaagtggttccttctgcctctgctctg
attatcaaagctctgaaggagcccccccgtgacagaaagaagcagaaaaacataaagcac
agtggcagtgtcagcttcgatgagatagtgaacatcgctcggcagatgaggcacagatct
ctggctcgagagctgtctgggacaattaaggagattcttggaactgctcagtctgtgggc
tgcagcattgatggcaggcacccacatgatatcattgatgacatcaatagtggtgcaatc
gagtgcccagctagctaa

DBGET integrated database retrieval system