KEGG   Gallus gallus (chicken): 417317
Entry
417317            CDS       T01006                                 

Gene name
NDEL1
Definition
(RefSeq) nuclear distribution protein nudE-like 1
  KO
K16739  nuclear distribution protein NudE-like 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    417317 (NDEL1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Nde1-Su48 complex
    417317 (NDEL1)
SSDB
Motif
Pfam: NUDE_C Crescentin PRKG1_interact HALZ Golgin_A5 DUF1664 TPR_MLP1_2 Rootletin
Other DBs
NCBI-GeneID: 417317
NCBI-ProteinID: NP_001025867
CGNC: 787
UniProt: Q5ZKH4
Position
18
AA seq 343 aa
MDSEEIPTFSSPKEETAYWKELSLKYKQSFQEAREELAEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVETLKEKLEHQYAQSYKQVSLLEDDLSQTRAIKDQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDDKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGSENSFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNANSSMMSSNG
TKYPHPGHTSFFDKGAVNGFDQGTPGLGASRPSSAPGMLPLSV
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggacagtgaggaaattccgaccttctcaagtccaaaggaggaaactgcttattggaaa
gagctttccttgaagtacaaacaaagcttccaggaagctcgtgaagagctggctgaattt
caggagggaagcagagaattagaagctgagttggaagcacagctggtgcaggctgagcag
aggaatagggatttacaagcagataaccaaaggctgaaatatgaagtggaaacattaaag
gagaaactggagcaccagtatgcacaaagctacaagcaagtgtcattgttagaggatgac
ctgagccagacacgggccattaaagaccagcttcataagtatgtcagggagctggagcag
gccaatgatgacttggaacgtgcaaagagggcaacaatagtttcattggaagactttgaa
caaagactgaaccaggctattgagagaaatgcgtttttggaaagtgaactggatgacaag
gagtcattgctagtttctgtacagagattaaaggatgaagcgagagacctgcggcaggag
ctggcagtacgggaaaggcagcaggaagtcacccgcaagtctgcgccgagctctccaact
ctagactgtgaaaagatggattcagctgtccaggcgtctctctccttgccagctacgcct
gttggaaaaggatctgaaaatagttttccttccccaaaagctataccaaatggatttggt
acaagccctcttactccttcagctagaatatctgcactcaacatcgtgggagatctctta
cggaaagtgggggccttagaatccaaattagctgcttgcagaaattttgcaaaggaccag
gcatcacggaaatcctacatttcagggaatgctaacagcagcatgatgagcagcaacggc
acgaagtaccctcatccagggcatacttctttctttgacaaaggggcagtaaacggcttt
gatcaagggaccccaggactgggagcctccagaccatcatcagcacctggcatgctaccc
ctgagtgtatga

DBGET integrated database retrieval system