KEGG   Gallus gallus (chicken): 417429Help
Entry
417429            CDS       T01006                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    417429 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    417429 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    417429 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    417429 (CACNG5)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   417429 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 417429
NCBI-ProteinID: XP_015135443
CGNC: 2865
Ensembl: ENSGALG00000003911
UniProt: E1C4A6
Position
18
AA seq 279 aa AA seqDB search
MLLGMSACSRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQSAEIKLSLHA
GLWRVCFLAGEERGRCFTIEYVMPMNIQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSETFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDIYRPHPGFYRPRLSNCSDYSGQFLHPDA
WARGRSPSDISSEASLQMNSSYPALLKCPDYDQMSSSPC
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggggatgagcgcctgcagcaggaaggcgctgaccctgctcagcagcgtgttc
gccgtctgcggcctcggcctgctgggcatctctgtcagcaccgactactggctctacctg
gaggaaggtatcgtccagccccagaaccagtcggctgaaatcaagctgtcgctgcacgca
gggctctggagggtctgcttcctggcaggtgaggaacgtggccggtgcttcactatagaa
tacgtcatgcccatgaacattcagctgacgtctgaatccacagtcaacgtcctgaagatg
atccgctctgccacccccttccctctggtcagcctcttcttcatgttcatcggcttcatc
ctgagcaacatcggccacgtgcggccgcacaggaccatcctcgccttcgtgtcggggata
ttcttcatcttgtcaggtctgtccctggtggtggggctggtcctctacatatccagcatt
aacgatgagatgctcaataggaccaaggactcggagacattcttcaattacaaatacggc
tggtcgttcgcattctctgccatctcgttccttctcacagagagcgctggggtgatgtcc
gtgtacctgttcatgaagcgatacaccgctgaggacatttacagacctcaccccggcttc
taccgtccccgtctgagcaactgctccgactactcggggcaattcctgcacccagacgca
tgggcgcggggccgcagcccttcagacatctccagtgaggcatctctgcagatgaacagc
agctacccggctctgctcaagtgccctgactacgaccagatgtcctcatccccgtgctga

DBGET integrated database retrieval system