KEGG   Gallus gallus (chicken): 417430Help
Entry
417430            CDS       T01006                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04150  mTOR signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04310  Wnt signaling pathway
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    417430 (PRKCA)
   04012 ErbB signaling pathway
    417430 (PRKCA)
   04310 Wnt signaling pathway
    417430 (PRKCA)
   04370 VEGF signaling pathway
    417430 (PRKCA)
   04020 Calcium signaling pathway
    417430 (PRKCA)
   04070 Phosphatidylinositol signaling system
    417430 (PRKCA)
   04150 mTOR signaling pathway
    417430 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    417430 (PRKCA)
   04540 Gap junction
    417430 (PRKCA)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    417430 (PRKCA)
   04916 Melanogenesis
    417430 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    417430 (PRKCA)
   04270 Vascular smooth muscle contraction
    417430 (PRKCA)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    417430 (PRKCA)
  09172 Infectious diseases: Viral
   05164 Influenza A
    417430 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    417430 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    417430 (PRKCA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     417430 (PRKCA)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   417430 (PRKCA)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    417430 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 417430
NCBI-ProteinID: NP_001012822
CGNC: 50506
Ensembl: ENSGALG00000025950
UniProt: Q5F3X1
Position
18
AA seq 674 aa AA seqDB search
MADVFPGSEPGAAPDAARRFARKGALRQKNVHEVKEHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTGDKLEVTVREA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTFRSTLNPHWNESFTFKLKPTDKDRRL
SVEVWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPDADEDGNAE
LRQKFEKAKLGPAGNKVITPSEDRNSSVPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADR
KNTEELYAIKILKKDVVIQDDDVECTMVEKRVLALQDKPPFLTQLHSCFQTVDRLYFVME
YVNGGDLMYHIQQVGKFKEPQAVFYAAEISVGLFFLHNRGIVYRDLKLDNVMLDSEGHIK
IADFGMCKEHMLDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPF
DGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGLEGERDIREHAFFR
RIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSY
VNPQFVHPLLENVA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtgttcccgggctccgagcccggcgcggccccggacgcggcgcggcgcttt
gctcgcaaaggggccctgaggcagaagaacgtgcacgaggtgaaggagcacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggattt
gggaaacaaggatttcagtgccaagtttgctgttttgtggttcataagagatgccatgag
ttcgttaccttctcctgtcctggagctgacaagggacctgacaccgatgaccccaggagc
aagcacaaatttaagatccacacctatgggagcccaaccttctgtgaccactgtgggtcc
cttctttatgggctcctacaccaagggatgaaatgtgacacttgtgatatgaatgtgcat
aagcaatgtgtgataaacgtcccgagcctctgtggcatggatcacactgagaaaagggga
aggatttatctgaaggctgaagtcactggtgacaaactggaagtaacagtgcgagaagca
aaaaacctaattcccatggatccaaatgggctttcagatccttatgttaaactgaaactt
atcccagatcccaagaatgaaagtaaacaaaaaacaaaaaccttccgttctaccctgaat
ccacactggaatgagtcattcacatttaaattaaaacctacagacaaagatcgacggctc
tctgtagaggtctgggactgggatcgaacaaccaggaatgattttatgggctctctttca
tttggggtgtcagagctcatgaagatgccagccagtggatggtacaagctgctgaatcaa
gaagaaggtgaatattataatgttccaattccagatgctgacgaggatggaaatgcagag
ctccggcagaagttcgagaaagccaaacttgggccagctggtaacaaagtcattactcca
tcagaagacaggaattcaagtgtgccatccaacaatctggacagggtgaaactgacagat
ttcaactttcttatggttcttggaaaaggaagctttggaaaggtgatgctggcggacagg
aagaatacagaggagctctatgcaatcaaaatactgaaaaaagatgtggtgattcaggat
gatgatgttgagtgtacaatggttgaaaaacgagtgctagcactgcaggataaaccacca
ttcctgacacagcttcactcatgtttccaaacagttgaccgcctgtattttgttatggag
tatgtgaatggtggggatctcatgtaccacattcagcaagtaggaaaatttaaggagcca
caagcagtgttctatgcagctgagatctcagttgggttattctttctccataatagaggg
attgtttatagagatctgaaattggataatgtgatgttggattcagaaggacacattaaa
attgctgactttggaatgtgcaaagaacatatgttagatggagtaacaaccaggaccttc
tgtggcaccccagattacatcgcaccggagatcattgcttatcagccctatgggaagtct
gtggattggtgggcatatggagtgctgctctacgagatgttagctggccagcctccattt
gatggagaagatgaagatgaacttttccagtccataatggaacataatgtttcctatcca
aaatcgctgtccaaagaagctgtctccatctgcaaggggctaatgactaaacatcccgca
aagcgccttggctgcggcctcgaaggtgaaagagacatcagggaacacgctttcttcagg
agaattgactgggagaaactggaaaacagagagatccagccacctttcaagcccaaagtg
tgtggcaaaggtgctgaaaacttcgataaattcttcacgcgaggacagccggtgttgacc
ccgccagaccagctggtcattgctaacatagatcaatccgattttgaagggttctcctat
gtcaacccccagtttgtacatcccctcctagaaaatgtagcatga

DBGET integrated database retrieval system