KEGG   Gallus gallus (chicken): 417434Help
Entry
417434            CDS       T01006                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
gga  Gallus gallus (chicken)
Pathway
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    417434 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    417434 (GNA13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    417434 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    417434 (GNA13)
   04031 GTP-binding proteins [BR:gga04031]
    417434 (GNA13)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   417434 (GNA13)
  Exosomal proteins of colorectal cancer cells
   417434 (GNA13)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    417434 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 417434
NCBI-ProteinID: XP_415686
CGNC: 3014
Ensembl: ENSGALG00000036028
UniProt: A0A1D5PQE8
Position
18
AA seq 377 aa AA seqDB search
MADFLPSRSVLSGCFPGCLLTSGEAEQQRKSKEIDKCLNREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDWDRAAREEFRATIYSNVIKGVRVLVDAREKLHIPWGDPVNQSNGD
TMMAFDTRSVTVVQGMVETAVFLQYLPAIRALWADSGIQHAYDRRREFQLGESVKYFLDN
LDKLGEQDYLPSQQDILLARRPTKGIHEYNFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QKVSIKDYFPDFEGDPHCLTDVQKFLVDCFRTKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcgctccgtgctgtcgggctgtttccccggctgcctgctg
accagcggcgaggccgagcagcagcgcaagtccaaggagatcgataagtgcctcaaccgg
gagaaaacctacgtgaagcgcctcgtcaagatcctgctgctgggcgcgggggagagcggc
aagtccaccttcctcaagcagatgcggatcatccacgggcaggactgggaccgggcggcc
cgcgaggagttccgggccaccatctacagcaacgttatcaagggtgtgagagtccttgtg
gatgccagagagaaacttcatatcccttggggagatcctgttaaccagagtaacggggat
acgatgatggctttcgatacccgctcagtcacggtggtgcaaggaatggtggagacagca
gtttttttacagtacctcccggccataagagctctatgggcagacagtgggatccagcat
gcatacgacaggcgcagagaattccagttgggggaatccgtaaaatatttcttggacaac
ttggataaacttggagaacaggattatcttccctcacagcaagatattctgctggcacga
agacccacaaaagggattcatgagtacaactttgaaataaagaatgttcctttcaaaatg
gttgatgtaggtggccaaaggtcagaacggaaacgttggtttgaatgcttcgacagtgtc
acatcaatactcttccttgtttcctcaagtgaatttgaccaagtgcttatggaggatcgg
caaacgaatcgccttacggagtccctgaacatttttgaaacaatagtcaataaccgggtt
ttcagcaacgtctccatcattctcttcttaaataagacggacttgcttgaggaaaaagta
caaaaagtgagcatcaaagactattttccagattttgaaggggatccccactgcttaacg
gatgtccaaaaattcctggtggattgttttcgtaccaaacgccgggaccagcagcagaag
cccctctaccaccacttcaccactgctattaacacagaaaacatccggctagtctttcgt
gatgtcaaggataccatccttcatgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system