KEGG   Gallus gallus (chicken): 417450
Entry
417450            CDS       T01006                                 

Gene name
FAM104A
Definition
(RefSeq) protein FAM104A
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: FAM104
Other DBs
NCBI-GeneID: 417450
NCBI-ProteinID: NP_001025879
CGNC: 66279
Ensembl: ENSGALG00000026401
UniProt: Q5ZKJ7
Position
18
AA seq 149 aa
MSCRQPLPSERGARQRKRRRNGNEEDSHIPQTKRSTRNTVLQDSWDTEKVAVTKNSKEHR
LKGNKVSCASSSSDSGSSSSSCSSSSINSPDRASGSEPSLNPIVTGSSPVSSQSFHEQSA
LSQGPYFHINQILKEAHFHSLQSRGRPPT
NT seq 450 nt   +upstreamnt  +downstreamnt
atgagctgccggcagccgctgcccagcgagcggggagccaggcagaggaagaggaggcgc
aatggtaatgaagaagacagtcatattccacagaccaaacgtagtaccaggaataccgtc
cttcaggactcttgggacactgagaaggtggctgtaacgaaaaacagtaaggaacacaga
ctaaaaggaaacaaagtgtcctgtgcgtcctccagcagcgatagcggcagcagcagcagc
agctgtagtagcagtagcatcaacagccctgacagagcgagcggctcagaacccagcctg
aaccccatagttacgggatccagccctgtctcctctcagtccttccatgagcaatctgca
ctaagtcaaggtccttacttccacatcaaccagatcctgaaggaggcacacttccacagc
ttacagagccggggacgccctcctacatga

DBGET integrated database retrieval system