KEGG   Gallus gallus (chicken): 417504
Entry
417504            CDS       T01006                                 

Gene name
COL26A1
Definition
(RefSeq) collagen alpha-1(XXVI) chain isoform X4
  KO
K24358  collagen type XXVI alpha (EMI domain-containing protein 2)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    417504 (COL26A1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 C1q domain-containing proteins
  Emilin / mutimerin group proteins
   417504 (COL26A1)
SSDB
Motif
Pfam: Collagen EMI
Other DBs
NCBI-GeneID: 417504
NCBI-ProteinID: XP_004946529
CGNC: 1229
Ensembl: ENSGALG00000043223
Position
19
AA seq 491 aa
MRFALFLSWCCCLHGCALGTGFLYQFPASTLQHNYPEQSSGSPGSGFASRRHWCHYTVTR
TVSCQVQNGSETVIQRVYQSCRWPGPCANLVSYRTLIRPTYKMSYRTVTTLEWRCCPGFT
GSNCEEECMNCTRLADMTERLNTLEAKILLLEAAERSPPLENNLPITGTTATWYDDLLPD
AFPLLNPGTVLRKTVGPVDPKGHRGAEEQLIPQGIPGQVGPPGPVGPTGLPGPPGPKGEK
GQPGERGPAGPPGLLGPQGPRGLPGETGIPGPPGPPGPPATPSLPLTFQQGVLYSLQPTA
EKENGEPQLASTVIDTIMAGLPGPRGAPGPVGPPGPPGASGPKGPPGPIGVPGSQGLPGS
PGQPGPKGSKGDRGERGQAGLTGERGIKGFPGEPGKKGEEGDKGADGEGVQQLREALKIL
AERVLILEHMIGIHDSLSSIEPGSGQDVIPGSPLRSSIKIKRGGPQQPHAYQILSSLLDD
SEAKRRSSRMK
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcgcttcgctcttttcttgtcctggtgctgctgcctgcacggatgcgcgctgggaacc
ggcttcctctatcagttcccggcatcgaccctgcagcacaactaccccgagcagagctct
ggctcgccgggcagcggcttcgccagtcgccggcactggtgtcactatacggttacaagg
acagtctcctgtcaagtgcagaatgggtcagaaacggtgatccagcgagtttatcagagc
tgccggtggccaggaccttgtgccaacttagtgagttacaggactcttataaggcccacg
tacaaaatgtcctaccgaactgtgaccacgctggagtggaggtgctgtcctgggttcaca
gggagcaactgcgaagaggaatgcatgaactgcacaagactagcagatatgaccgagagg
ctgaacacgcttgaggccaagatccttctgcttgaagccgcggagcgaagcccaccactg
gaaaacaacctgcccatcactgggaccacggccacctggtatgacgacttgctgccggat
gcctttcctctgctaaatcctgggactgtcctgaggaaaacggtgggacctgttgatcct
aaaggacacagaggagcagaggagcagctaataccacaggggattccaggacaggttggt
cctccaggcccagttggaccaactggtcttccaggaccaccgggaccaaaaggcgagaag
ggacaacctggggagaggggcccagcagggccaccagggctgttgggacctcaaggacca
agaggacttccaggagaaaccggaattccaggtcccccaggtcctccagggccacctgcc
accccaagccttccacttaccttccagcaaggggttctctactccctccagcccacagcc
gaaaaagaaaatggagaaccccagctggcctccaccgtcatagataccatcatggctggc
ctgccaggaccgcggggagcaccgggccctgtgggacccccaggaccaccaggtgcatcg
ggacccaaagggcccccaggacctattggagtccctggatcacaaggcttaccaggctct
ccaggacaacctgggcccaaaggctccaaaggagaccggggagagagggggcaagcaggt
ctgactggagagaggggcattaagggatttcctggtgaaccaggcaagaagggcgaggaa
ggtgataaaggtgctgatggggaaggtgttcaacaacttcgagaagctctgaagatttta
gctgagagggtcttgattctagagcacatgataggaattcacgactctttatcttccatt
gagccaggctccggacaagacgtgatcccgggttcccctctgcgaagcagcatcaagatc
aagcgtggaggaccccagcagccgcacgcctaccagatcctctcttcactgctggatgac
agtgaagccaaaaggagaagcagtcggatgaagtag

DBGET integrated database retrieval system