KEGG   Gallus gallus (chicken): 417584
Entry
417584            CDS       T01006                                 
Symbol
GIT1
Name
(RefSeq) ARF GTPase-activating protein GIT1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    417584 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    417584 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    417584 (GIT1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    417584 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    417584 (GIT1)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_5 Ank_4 Ank Shugoshin_N Jnk-SapK_ap_N ZapB T7SS_ESX_EspC YabA ADIP TTRAP
Other DBs
NCBI-GeneID: 417584
NCBI-ProteinID: NP_989627
CGNC: 50555
Ensembl: ENSGALG00000023703
UniProt: Q9DG15
Position
19:complement(6209778..6217603)
AA seq 740 aa
MSRKAQRAEVCADCSAADPGWASINRGVLICDECCSVHRSLGRHISIVKHLRHSPWPATL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPTKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQI
LQAELLVVYGADPGAPDVNGRTPIDYARQAAQHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLTTQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLLIDILGEAKRRQQGKSP
LSPTDALDYSLRSQSDLDDQHDYDSVASDEDTDQELLRNASRNNRARSMDSSDLSDGPIT
LQEYLEVKKALAASEAKVQQLMKVNNSLSDELRRLQREIHKLQSENTQIRQQAVPPHPTP
APSERPEHGHPPGTAPLHRRDRQAFSMYEPGSVLKPFGQPVEELVTRLQPFGGGMRKGPS
VSSMPFPPSSPLLSCPPDGARHMSKLDRHGSGTDSDYDNTQTGEILLGVEGKRFVELSKD
EDFPHELDPLDGELDPGLPSTEDVILKTEQVTKNIQELLRAAQESKHDSFVPCSEKIHSA
VTEMASLFPKKPALETVRSSLRLLNASAYRLQSECRKTVPPEPGAAVDYQLLTQQVIQCA
YDIAKAAKQLVTITTREKKQ
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgtcccggaaggcgcagcgggcggaggtgtgcgcggactgcagtgccgcagacccgggc
tgggcctccatcaaccgcggtgtgctcatctgcgacgagtgctgcagcgtgcaccgcagc
ctgggccgccacatctccatcgtcaagcacctgcggcacagcccctggcccgccacgctg
ctgcagatggtgcacaccttggccagcaatggggccaactccatctgggagcattcgctg
ctggacccggcgcaggtgcagagcgggcgcaggaaggcgaacccccaggacaaagtgcac
cccaccaagtcggagttcatccgcgccaagtaccagatgctggccttcgtgcacaagctg
ccgtgccgggatgacgacggggtcaccgccaaggacctcagcaagcaattgcactccagc
gtgcggacgggcaacctggagacgtgcctgcgcctgctctcgctgggggctcaggccaac
ttcttccacccggagaagggcaccacgccgctgcacgtggctgccaaggccgggcagatc
ctgcaggcggagctgctggtggtgtacggcgctgaccccggtgcgcccgacgtcaacggg
cggacacccatcgactacgccaggcaggcggcccagcacgagctggcggagcggctggtg
gagtgccagtatgagctgaccgaccggctggccttctacctgtgcggcaggaagccggac
cacaagaacgggcactacatcatcccgcagatggcagacagcctggacctgtccgagctg
gccaaggcggccaagaagaagctgcaagcgctcagcaaccgcctgtttgaggagctggcc
atggatgtgtacgacgaggtggatcggcgcgagaacgacgcggtgtggctgacgacgcag
aaccacagcacgttggtgaccgagcgcagcgccgtccccttcctccccgtcaaccccgag
tactccgccacccgcaaccagggccggcagaagttggccaggttcaacgcccgggagttt
gccactctgctcatcgatatcctgggggaagccaagcgccggcagcaggggaagagcccg
ctcagccccacggatgccctcgactattcgctgaggagccagagtgacctggacgaccag
cacgactacgacagcgtcgcctccgacgaggacacggaccaggagctgctgcgcaacgcg
tcccgcaacaaccgcgcacggagcatggactcctctgacctgtcggacggccccatcacg
ctgcaggagtacctggaggtgaagaaagccctggccgcctccgaggccaaagtgcagcag
ctgatgaaggtgaacaacagcctgagcgatgagctgcgccggctgcagcgcgagatccac
aagctgcaatcagagaacacgcagatccggcagcaggcggtgcccccacaccccacccca
gcccccagcgagcgccccgagcacgggcacccccccggcacggcccccctgcaccgccgt
gaccgccaggccttctccatgtacgagccgggctcggtgctgaaaccctttgggcagccg
gtggaggagctggtgacccggctgcagcccttcggaggcggcatgcggaagggtccgtcg
gtctcctccatgccttttcccccatcctccccgctgctctcctgcccacccgatggtgcc
cggcacatgagcaaactggaccggcacggcagcggcaccgacagcgactacgataacacg
cagacgggcgagatcctgctgggcgtggaggggaagcgcttcgtggagctgagcaaggac
gaggacttcccccacgagctggacccgctggacggggagctggaccccgggctgcccagc
acggaggacgtcatcctgaaaaccgagcaggtcaccaaaaacatccaggagctgctgcgg
gctgcgcaggagtccaaacacgacagcttcgtgccgtgctccgagaagatccactcagcc
gtgacggagatggcgtcgctcttccccaagaaaccggcgctggagacggtgcggagctcc
ctgcgcctgctcaacgccagcgcctaccggctgcagagcgagtgccgcaaaaccgtgccg
ccggagccgggcgcagccgtggactaccagctgctgacacagcaggtcatccagtgcgcc
tacgacatcgccaaggcggccaagcagttggtcaccatcaccacccgcgagaagaagcag
tga

DBGET integrated database retrieval system