KEGG   Gallus gallus (chicken): 417715
Entry
417715            CDS       T01006                                 

Symbol
SLC26A5
Name
(RefSeq) prestin
  KO
K14703  solute carrier family 26, member 5
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    417715 (SLC26A5)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   417715 (SLC26A5)
SSDB
Motif
Pfam: Sulfate_transp STAS Ribosomal_S6 MFS_MOT1
Other DBs
NCBI-GeneID: 417715
NCBI-ProteinID: NP_001072945
CGNC: 6231
Ensembl: ENSGALG00000008222
UniProt: A0FKN5
Structure
PDB: 
5EZB

Position
1
AA seq 742 aa
MEDAQESGECLVQNQKYCVERPIYNQEILQGQLHKRERTPQSLRQKIEHSCRCSSKKAKS
HLYSFLPILKWLPRYPVKEYLLGDIISGISTGVMQLPQGLAYALLAAVPPVFGLYSSFYP
VFLYTFFGTSKHISIGTFAVISMMVGGVAVRQVPDEVISVGYNSTNATDASDYYSLRDDK
RVQVAVTLAFLSGIIQLCLGFLRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKT
SRYSGPLSVVYSLVAVFSKITTTNIAALIVGLTCIALLLIGKEINLRFKKKLPVPIPMEI
IVVIIGTGVSAGMNLTESYGVDVVGKIPQGLSAPAVPEIQLIPAIFIDAVAIAIVGFSMA
VSMAKIFALKHGYTIDGNQELIALGICNSVGSFFQSFPITCSMSRSLVQESTGGKTQIAG
ALSSIMVLLVIVAIGYLFEPLPQTVLAAIVMVNLKGMFKQFADVAHFWRTSKIELAIWVV
AFVASLFLGLDYGLLTAVAFAMITVIYRTQRPQYRILGQIPDTDIYCDVEEYEEVKEYPG
IKIFQANTSLYFANSESYTSALKKKTGVDPCAILAARRKAQKKHAREIKKANKVKKKAVL
KLVNSSTNDVEASVKHEIANDGLPANGKFAFVDAGVQDGSPDELEHFVEPKTNVHSLILD
FAPVNFVDSVGAKTLKSVIKEYNEVGVCVCIASCSGPVMNELTRLNFFDNTVTRELLFHS
IHDAVLACQGKDRSASQTALDH
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaagatgctcaagaaagtggagagtgtcttgtgcaaaaccagaagtattgtgtggag
agaccaatatataaccaagagatcttgcaaggacagttgcacaaacgagaaagaacacct
cagagtttgaggcagaaaattgaacactcttgtcgatgctcttctaagaaagccaagtct
catctttacagtttcttaccaattttaaaatggcttccccgttacccagtgaaggaatac
ttattaggagatattatctcaggtataagcactggagttatgcagcttcctcaaggttta
gcttatgctttgctggcagctgttcccccagtatttggcctatattcttcgttttatcct
gtctttctgtatactttttttgggacctccaagcatatatcaataggcacttttgctgtg
attagtatgatggttggcggggttgctgtgagacaagtgcctgatgaagtgatctctgta
ggctataactcaactaacgctacagatgcctcagattactacagtcttagggatgacaag
cgggtgcaagtagctgtgaccctcgcctttctttcaggaattatccagttgtgtttaggt
tttcttcgatttgggtttgtcgccatctatttaacagagcctctggtgcgaggatttact
actgctgctgcagttcatgtcttcacttcacagttaaagtatctgcttggagtaaagact
agccgatacagtggacccctctcagttgtatacagcctagttgctgtgttttcaaaaata
acaacaaccaatattgctgcactgattgttgggttaacgtgcattgctctattgctgatt
ggcaaggaaatcaatctccgatttaagaagaaactgccagttcctattcctatggagatc
attgtggtcattatcggcacaggagtttcagctggaatgaatctgactgagtcatatgga
gtggatgttgttgggaaaattcctcaagggttaagtgcaccagcagttcctgagattcaa
ctcatcccagcaatatttatagatgcagtagcaatagcaatagttggattttcaatggct
gtatctatggccaagatctttgcccttaaacacggttacaccattgatgggaatcaggaa
cttattgccttgggaatatgtaactctgtggggtcgtttttccaaagctttccaatcact
tgttcaatgtcccggagtctcgttcaggaaagcactggtgggaaaactcagattgcaggt
gcactctcttcaattatggttctgttggtaattgtggcaattggatacctctttgagcca
cttccacagacagtgctggctgcaattgtaatggtgaacctgaaaggaatgtttaagcag
tttgcagacgttgcacacttctggagaaccagtaagatcgaactggccatctgggtggta
gcttttgtggcttctcttttcctgggactagactatggtttgcttactgcagtagcattt
gcaatgataaccgttatttacagaacacaaagacctcaatatagaatccttggccagatt
cctgacacagatatctactgtgatgtggaagagtatgaagaggttaaagaatatcctgga
ataaaaatatttcaagctaatacgtcactttattttgccaatagtgagtcgtacacaagt
gcactgaagaaaaagactggagtggacccttgtgccatattagcagcaagaagaaaggcc
cagaagaagcatgccagggagataaagaaggccaataaagtcaaaaagaaagctgtactg
aagctagtgaattcttcgactaatgatgtggaagcgagcgtaaaacatgagatagcaaat
gatgggctacctgcaaatggaaaatttgcatttgtggatgctggtgtacaagatgggtct
cctgatgagcttgaacactttgtggagcccaaaacaaatgtccactctttaattctggat
ttcgccccagtgaactttgtggattcagttggagcaaaaacattaaaatcagttataaaa
gaatataacgaagttggtgtctgtgtctgtattgccagctgtagtggcccagttatgaat
gagctgacaagactgaatttttttgataacactgtaacaagagagttgctgtttcacagt
attcatgatgctgtccttgcttgccaagggaaagacaggtctgcttcacagactgcctta
gaccactga

DBGET integrated database retrieval system