KEGG   Gallus gallus (chicken): 417737
Entry
417737            CDS       T01006                                 

Gene name
MLC1
Definition
(RefSeq) membrane protein MLC1 isoform X1
  KO
K20070  membrane protein MLC1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    417737 (MLC1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    417737 (MLC1)
SSDB
Other DBs
NCBI-GeneID: 417737
NCBI-ProteinID: XP_004937559
CGNC: 6495
Ensembl: ENSGALG00000040038
UniProt: A0A1D5PIT5
Position
1
AA seq 379 aa
MTREEGYREEFSYDRMPTLERGKQENGNYIPDIKSSDLQLSKRLHPCFIYRTWIFSLLMG
SCLLITSGFSLYLGNIFPSEMDYLRCAAGSCIPSAVVSFAIARNKINVIPNFQILFVSTF
AVTTTCLIWFGCKLVLNPSAININFNLILLILLEIFMATTVIISARSTEDCCMRKKNTTY
DSAVVLSNVSFPARILKSYSVIEVIIGISSVFGGIIALNMDVLVSGPYLSVTFFWILVAC
FPSAIASHVAAEYPSKCLVEVLIAISSVTSPLLFTASGYLSFSIMQVVDIFKNYPPPVKQ
SYDVLLLLLMLMLLIQACLTIGTVIQCVNYKTKMKLQDSSWTESQVKKQEYRTTEVSNNT
LKDFDKDKAWKAVVVQMAQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgaccagggaagaaggttacagagaagaattcagctatgacaggatgccaactttggag
cggggaaagcaagagaacggaaattatataccggatatcaaatctagtgaccttcagcta
tcaaagaggctgcacccttgctttatttacagaacgtggatcttttctttgctgatgggt
agttgcctccttattacatctgggttttcactgtatctgggaaatatttttccatctgaa
atggattatttacgttgcgcagcaggttcatgtattccttcagcagttgtgagctttgct
atagcaaggaataaaattaatgtgatacccaattttcagattctgtttgtctctacattt
gctgttacaacaacatgtttaatttggtttggatgcaaacttgtcctgaatccatcagct
ataaatataaatttcaacctgattctacttattctgctggaaatcttcatggcaactact
gtgatcatttctgctagatctactgaagactgctgtatgagaaagaaaaataccacatat
gatagtgccgttgttttgagtaatgtcagctttcctgcccgaattctgaagtcatactca
gtaattgaagtgattattggaatttcatcagtatttggtggcataattgctttaaatatg
gatgttctagtctcaggtccatatctttcagtaacattcttttggatcttggttgcttgc
tttcctagtgctattgcaagtcatgtggctgctgaatatccaagcaaatgtctggttgag
gtcctgattgccattagcagtgtcacatccccattgttgttcactgcttctggatactta
tccttcagtatcatgcaagttgttgacatctttaaaaattatccacctcctgttaaacag
tcttatgatgtactactgttgcttctgatgttgatgctgctaattcaggcatgccttact
attggaactgtaatacagtgtgtaaattacaagacaaaaatgaaactgcaggattcgtcc
tggacagagtcacaggttaaaaaacaggagtacagaactacagaggtttccaataatacc
ttaaaggattttgacaaagacaaagcctggaaagcagttgtggtgcagatggctcagtag

DBGET integrated database retrieval system