KEGG   Gallus gallus (chicken): 417741
Entry
417741            CDS       T01006                                 
Name
(RefSeq) secreted frizzled-related protein 5
  KO
K23599  secreted Xwnt8 inhibitor sizzled
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    417741
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I93
   417741
SSDB
Motif
Pfam: Fz
Other DBs
NCBI-GeneID: 417741
NCBI-ProteinID: XP_415985
CGNC: 50585
Ensembl: ENSGALG00000008635
UniProt: F1NLQ7
Position
1:complement(20505030..20508702)
AA seq 286 aa
MLLTAKILVFTLSVFLGVGTSFDIGLSTKCVVIPKEMDMCHEIGYSEMRLPNLMGHTSMA
EVVLKSTTWQHLVHTDCHPHVRMFLCSLFAPICLDTFIHPCRSMCVGVRDSCAPVLACHG
HTWPESLDCNRFPADEDMCLASLTKEYKYLHKVLPKPACQTCPAVEELFTHKRLLEVFCD
SNFAVKVKLSKKRAVIGDQEYSIECHVEFITQGSLLPYETQHMIQQWLLINENCTQRMTQ
THRPTVYLLVGKIEEGIILVNQIYHWQRRDSQLTLATQKWRYHKCL
NT seq 861 nt   +upstreamnt  +downstreamnt
atgctgttgactgcaaaaatacttgttttcactctgagtgttttcctaggagtgggcaca
agttttgacattggattatccaccaaatgtgtagtgatacccaaggagatggacatgtgc
cacgagattgggtactccgaaatgaggcttcccaacctgatgggacacacaagcatggca
gaggtcgtcctaaaatccaccacctggcagcacctggtgcacacggactgtcaccctcat
gtgaggatgttcctgtgctctctgtttgcacccatctgcctggacacgttcatccatccc
tgtaggagtatgtgcgttggtgttcgggacagctgcgcgcctgtacttgcctgccatggg
cacacctggccagaaagcctggactgcaaccggttccctgcagacgaggacatgtgtctg
gcatcgcttacaaaggaatacaaatacttgcacaaagtcctaccgaagcctgcatgccag
acctgcccagcagtggaggaactcttcacgcacaaaagacttctcgaagttttctgtgac
agtaatttcgcagtgaaagtaaagctgtccaaaaaaagagcagtaatcggcgaccaagag
tacagcattgaatgccatgtggaattcattacccagggctcactcttgccttatgaaact
cagcacatgatacagcaatggctgctcatcaatgaaaactgtacacagaggatgactcaa
acccatcgtcctacggtgtatctccttgtagggaagattgaggagggtatcattttagta
aatcagatttatcactggcagaggagggactcccagctgactttggccactcagaagtgg
aggtaccataaatgcttgtaa

DBGET integrated database retrieval system