KEGG   Gallus gallus (chicken): 417769
Entry
417769            CDS       T01006                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04150  mTOR signaling pathway
gga04310  Wnt signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    417769 (WNT2)
   04150 mTOR signaling pathway
    417769 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    417769 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    417769 (WNT2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Morphogens
   417769 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 417769
NCBI-ProteinID: XP_416013
CGNC: 66296
Ensembl: ENSGALG00000030173
UniProt: A0A1D5NTF4
Position
1
AA seq 376 aa
MSAAPRECPDAERRAPAMASLFGIWWWSLPLVLLWATPRVASSWWYMGAVGSSRVMCDNV
PGLVSRQRQLCRRHPEAMLSIGRGVAAWTAECQHQFRRHRWDCSALERGQRLLGRVLQRS
SRESAFVHAISSAGVVFAITRACSQGELKSCSCDPEKKGSAKDSKGRFDWGGCSDNIDYG
VKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAM
ADFRKTGDYLWKKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFESSPDYCIRDRDV
GSPGTAGRVCNQTSRGMDSCEVMCCGRGYDTLRVSRMTKCECKFHWCCAVRCQDCLEEVD
IHTCKAPKAAGWASRT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtccgctgccccccgcgagtgccccgatgcggagcgccgcgcccccgccatggcctcg
ctcttcgggatctggtggtggtctcttcccctcgtgttgctgtgggcgaccccgcgagtc
gcctcctcgtggtggtacatgggggccgtgggatcgtcgcgggtgatgtgcgacaacgtg
ccggggttggtgagccggcagcggcagctgtgccggcggcaccccgaggccatgctgtcc
atcgggcgcggcgtggccgcctggacggccgagtgccagcaccagttccgccggcaccgc
tgggactgcagcgccctggagcgggggcagcgcctcctcggccgcgtcctgcagcgcagc
agccgggagtccgcgttcgtccacgccatctcctccgctggcgttgtgtttgccatcacg
agggcgtgcagccagggagagctgaagtcctgctcctgtgaccccgagaagaagggctct
gccaaggacagcaagggccgcttcgactggggcggctgcagcgacaacattgactatggc
gttaagttcgccagggccttcgtggatgccaaggaaaggaaagggaaggacgccagggcg
ctgatgaacctccacaacaaccgtgcaggaaggaaggccgtgaagcggtttttgaaacag
gagtgcaaatgtcacggtgtgagtggatcatgcactctaaggacctgttggctggccatg
gcagactttaggaaaacaggagattatctgtggaagaaatacaatggagcgattcaggtg
gtcatgaatcaagatggcacgggtttcactgtggctaataagagatttaagaagccaact
aagaatgacctggtatactttgaaagctctccagactactgtatcagggacagggatgta
ggctctccggggacggccggccgggtgtgcaaccagacgtcccgcggcatggacagctgt
gaggtgatgtgctgcggccgtggctacgacacgttgcgcgtcagcaggatgaccaaatgc
gagtgcaagttccactggtgctgcgcggtgcgctgccaggactgcctggaggaggtggac
atccacacgtgcaaggcgcccaaggctgcgggctgggcctcccggacatga

DBGET integrated database retrieval system