KEGG   Gallus gallus (chicken): 417773Help
Entry
417773            CDS       T01006                                 

Gene name
TFEC
Definition
(RefSeq) transcription factor EC
  KO
K15591  transcription factor EC
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    417773 (TFEC)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    417773 (TFEC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3371 HLH MITF_TFEB_C_3_N
Motif
Other DBs
NCBI-GeneID: 417773
NCBI-ProteinID: NP_001006229
CGNC: 7156
Ensembl: ENSGALG00000040557
UniProt: Q5XFQ6
Position
1
AA seq 380 aa AA seqDB search
MVWVRRWGTTHLENQSRYHIQQSQRYQVKQYLTLDTKLSSQTLSLSHSHTVQPTGVTSIF
RNGHMPPVSDIGTPESPVTKLLALGGEHENAMEEVIEDIINMESSFNDEGIGCSETPLLM
QRTLSSSILDIYNSDQGMAPANMSLTNASCPANLPVKRELTADTRAMAKERQKKDNHNLI
ERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQK
KLEHANRRLLLRIQELEIQARAHGLPVMSSLSAVDLAAQVIKQQSYPEENSVDYSQQMPL
AHGPNSDVCDGSTAFSDPLSHFTDLSFSAALKEEQQLEEILLDDTVSPFGADPLLSSTSP
AASKESSRRSSFSTDDGDDL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtatgggtaaggagatggggtacaacacacttggaaaatcagtctagatatcatatc
cagcaaagccagcggtaccaggtgaagcagtacttgacccttgacaccaagctgtccagc
cagactctctccctgtcccactcccacacagtccagcccacaggagtgacctctattttt
aggaacggacacatgcctccagtcagtgatattggcacaccagagagtcccgtgaccaag
ctgctggcccttggaggagaacatgaaaatgcgatggaagaggttattgaagacataatc
aatatggaatcaagctttaatgatgaagggataggttgctctgaaacgcctcttctgatg
caacgaactctatctagcagcattttggatatatataacagtgaccagggaatggcacca
gctaatatgagtctcacaaatgcttcttgtccagctaatctaccagtaaaaagggaactc
acagcagatacgcgagcaatggccaaggagagacaaaaaaaggataaccacaatctcatt
gagagaagaagaaggtataacattaattaccgaatcaaggagcttggcacgctcatcccc
aagtctaatgatcctgatatgcgctggaacaaaggaactattttaaaagcatcagtggag
tacatcaagtggctacaaaaagaacaacagagagccagagaattagaacacagacagaag
aaattagagcacgctaacagaagacttctacttcgaattcaggaactagagatccaggca
cgtgctcatggccttccagtcatgtcttcactcagtgcagtagatttagctgctcaggtc
atcaagcaacagtcatatccagaggagaactctgtagactactctcaacaaatgcctctg
gctcatggaccaaattctgatgtttgcgatggatctacagccttttctgatccactttcc
catttcaccgatttgtccttcagtgcagctttaaaagaagagcaacaactagaggaaatc
ttgttggatgacacagtatcaccatttggagcagacccgctcttgtcctccacatcccca
gctgcgtcgaaagagagcagcaggagaagcagctttagcacagatgatggtgatgattta
taa

DBGET integrated database retrieval system