KEGG   Gallus gallus (chicken): 417799
Entry
417799            CDS       T01006                                 

Gene name
NELL2
Definition
(RefSeq) protein NEL precursor
  KO
K24342  protein kinase C-binding protein NELL
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    417799 (NELL2)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   417799 (NELL2)
SSDB
Motif
Pfam: EGF_CA VWC EGF_3 cEGF Laminin_G_2 EGF Laminin_G_1 Laminin_G_3 EGF_MSP1_1 TILa hEGF FXa_inhibition
Other DBs
NCBI-GeneID: 417799
NCBI-ProteinID: NP_001025911
CGNC: 7309
Ensembl: ENSGALG00000009601
UniProt: Q90827
Position
1
AA seq 816 aa
MESGCGLGTLCLLLCLGPVVGFGVDPSLQIDVLSELGLPGYAAGVRQVPGLHNGSKAFLF
PDTSRSVKASPETAEIFFQKLRNKYEFTILVTLKQAHLNSGVIFSIHHLDHRYLELESSG
HRNEIRLHYRTGSHRSHTEVFPYILADDKWHRLSLAISASHLILHVDCNKIYERVVEKPF
MDLPVGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFISQCPDLNRTCPTCNDFHGLVQK
IMELQDILAKTSAKLSQAEQRMNKLDQCYCERTCTMKGMTYREFESWTDGCKNCTCMNGT
VQCEALICSLSDCPPNSALSYVDGKCCKECQSVCIFEGRTYFEGQRETVYSSSGDCVLFE
CKDHKMQRIPKDSCATLNCPESQQIPLSHSCCKICKGHDFCTEGHNCMEHSVCRNLDDRA
VCSCRDGFRALREDNAYCEDVDECAEGQHYCRENTMCVNTPGSFMCICKTGYIRIDDYSC
TEHDECVTNQHNCDENALCFNTVGGHNCVCKLGYTGNGTVCKAFCKDGCRNGGACIASNV
CACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC
EDIDECATGRHSCANDTVCFNLDGGYDCRCPHGKNCTGDCIHEDKIKHNGQIWVLENDRC
SVCSCQSGYVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQSGELSYNSGDSWIQNCQ
QCRCLQGEVDCWPLPCPEVDCEFSVLPENECCPRCVTDPCQADTIRNDITKTCLDETNVV
RFTGSSWIKHGTECTLCQCKNGHVCCSVDPQCLQEL
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggagtccggctgcggcttaggcacgctttgccttctcctctgcctggggccagtcgta
ggcttcggcgtggacccctcgctgcagatcgacgtgctgtccgagctggggctgccgggc
tacgcggcgggcgtgcgccaggtgccggggctgcacaacgggagcaaagccttcctcttc
ccagatacttcaagaagtgtaaaggcgtctccagaaacagctgaaatcttttttcagaag
ttgagaaataaatatgaattcacaatcctggtgaccttaaaacaagcccatttaaattca
ggggttattttctctattcatcacttagatcacaggtatctggaattggaaagcagcggt
catcgaaatgaaatcaggttgcattaccgtacaggcagtcatcgctcccacacagaagta
ttcccatacatcctggcagacgataagtggcacaggctttccttagcaatcagtgcctct
cacttgattttacacgtggactgcaataaaatctatgaaagagttgtggagaagcccttc
atggacttacctgtgggtacaaccttttggctaggacagaggaataatgcacacggttat
tttaagggcataatgcaagatgtgcaattacttgtcatgcctcaaggatttatttctcag
tgcccagatcttaatcggacatgcccaacttgtaatgatttccatggacttgtgcagaaa
attatggaactgcaagacattttagctaaaacgtcagctaagctgtcgcaagctgagcag
aggatgaacaagttggatcagtgctattgtgaaaggacctgcacaatgaaaggcatgaca
tacagagaatttgaatcctggacagatggttgtaagaactgcacttgcatgaatggcact
gtgcagtgtgaagctttgatttgctccctctctgactgtccacctaattctgccctgtca
tacgtggatggcaagtgctgcaaagaatgtcaatcggtgtgcatatttgaaggcagaacc
tactttgaaggacaaagagaaacggtgtattcaagctcaggggactgtgttctgtttgag
tgcaaggaccacaaaatgcagcgtattccaaaagacagttgtgcaactttgaactgcccg
gaatctcaacagatcccattatctcacagttgctgcaaaatctgtaaaggccatgacttt
tgcactgaaggacataactgtatggagcattctgtctgccgaaacctagatgacagagct
gtctgtagctgccgagatggcttccgggcccttcgggaggacaatgcctactgtgaagat
gttgatgagtgtgccgaggggcagcactactgtcgggagaacaccatgtgtgtaaataca
ccaggatccttcatgtgcatctgcaaaacaggatatatacgcattgatgactattcatgt
acagagcacgatgaatgtgtaacaaaccagcacaactgtgatgaaaatgcgctatgtttc
aacacggtgggtgggcacaactgtgtctgcaagctgggttacacaggaaatgggacggtg
tgtaaagcattttgcaaagatgggtgcaggaatggaggagcctgtattgcttccaacgtg
tgtgcctgcccacaaggcttcactggccccagctgtgaaactgacattgatgaatgctct
gatggctttgtgcagtgtgacagccgtgctaattgcatcaatctgccagggtggtaccac
tgtgaatgcagggatggctaccatgacaatgggatgttttcaccaagtggagaatcctgt
gaagacattgatgaatgtgcaactggaaggcatagctgtgccaatgacactgtttgcttt
aacctggatggtgggtatgactgtcgatgtccacatggcaagaactgcacaggagactgt
atccatgaagacaaaatcaagcacaatggtcagatttgggtgctggagaacgacagatgc
tctgtctgctcatgccagagtggatacgtgatgtgccggcgaatggtctgtgactgtgaa
aatcccactgttgacctcttttgctgtcctgagtgtgacccaaggctcagcagtcaatgt
ttacatcagagtggggagctttcctacaacagtggtgactcctggatacaaaactgtcag
cagtgtcgctgcttgcaaggagaggttgactgttggcccttaccgtgcccagaggtagac
tgtgagttcagtgtcctccctgagaatgagtgctgcccacgctgtgtcactgacccctgc
caagcggacaccatccgtaatgacatcaccaaaacctgcctggatgaaaccaatgttgtt
cgcttcactggatcttcttggattaagcatggcacagagtgcacactctgccaatgtaag
aatggccacgtctgttgctcagtggatccacagtgccttcaggaactgtga

DBGET integrated database retrieval system