KEGG   Gallus gallus (chicken): 417837
Entry
417837            CDS       T01006                                 

Gene name
CAND1
Definition
(RefSeq) cullin-associated NEDD8-dissociated protein 1
  KO
K17263  cullin-associated NEDD8-dissociated protein 1
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    417837 (CAND1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    417837 (CAND1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    417837 (CAND1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   417837 (CAND1)
SSDB
Motif
Pfam: TIP120 HEAT_2 HEAT_EZ HEAT UME CLASP_N Vac14_Fab1_bd Adaptin_N Cnd1 Telomere_reg-2 MMS19_C RTP1_C1 DUF3385 VHS V-ATPase_H_C Uso1_p115_head RRN3
Other DBs
NCBI-GeneID: 417837
NCBI-ProteinID: XP_015138332
CGNC: 7517
UniProt: F1NHL2
Position
1
AA seq 1230 aa
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNMVFVDLIEHLLTELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALIARFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHVPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICSL
GDSLGTDLPSTLQIFLERLKNEITRLTTVKAMTLIAGSPLKIDLRPILGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLEFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQIELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVIGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLASGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNTELATIFESIQKDSSSTNLESMDTS
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcgagcgcctcgtaccacatctccaacctgctggagaagatgacgtccagcgacaag
gacttcaggtttatggctactaatgacttgatgacagaactacagaaagattctatcaag
ctggatgacgacagtgaaagaaaggtggtgaagatgattttgaaattactggaagataaa
aatggtgaggtgcaaaacttagctgtcaaatgccttggtcctttggtgagcaaagtgaag
gagtatcaagtggagaccattgtagatacactctgtacaaacatgctttcagataaagaa
cagttacgtgacatttcaagcattggccttaaaactgtgattggagaactccccccagct
tccagtggttctgcattagcagctaacgtttgcaaaaagatcacagggcgtctcactagt
gctatagccaagcaggaagatgtgtctgttcaattggaggcactagatatcatggctgat
atgctgagcaggcaaggaggactgcttgttaacttccatccttcaattctgacctgtctg
ctcccccagctgactagccccagacttgctgtgaggaaaagaaccatcattgctcttggt
cacctggttatgagttgtggcaatatggtttttgttgacctcattgaacatctgttgaca
gagctgtctaaaaatgattccatgtcaacaactaggacctatatacagtgtattgctgct
atcagtaggcaagcaggtcatagaataggtgaatatcttgagaaaataattcctttggtt
gtgaagttttgtaatgtagacgatgatgaactacgggagtattgcattcaagcatttgaa
tcctttgttaggagatgtcctaaagaagtttatcctcatgtatctactattataaatatt
tgtcttaaatatcttacctatgatccaaattacaattatgatgatgaagatgaagatgaa
aatgctatggatgctgatggtggtgatgatgatgatcaagggagcgatgatgaatatagt
gatgatgatgacatgagctggaaagtaaggcgtgcagctgctaaatgtctggatgctgtt
gttagcacacgacacgaaatgcttccagaattctacaaaactgtatctcctgctttaata
gccagattcaaagaacgtgaagaaaatgttaaagcagatgtttttcacgcttatctttct
cttttaaaacaaactcgacctgtgcaaagttggctttgtgatcctgatgcaatggaacaa
ggagagacacctttgacaatgcttcagagtcaggttcccaacatagttaaagccttgcac
aaacaaatgaaggagaaaagtgtgaagactcgtcagtgttgctttaatatgctgaccgag
ctagtaaatgtattacctggagccctaacacaacatgttcctgttcttgtaccaggaata
attttttcactgaatgacaaatcaagttcttctaatctgaagatagatgctttgtcctgt
ttgtatgtgatcctctgcaatcattctccccaagtctttcatcctcatgttcaagcactg
gtgcctccagttgtagcttgtgttggagatccattttacaagattacatcagaggcactt
ttggttactcaacaactagtgaaagtcattcgtcctttagaccagccttcttcctttgat
gctactccttacatcaaagatctctttacttgtacaatcaagagattaaaggctgctgac
attgatcaggaggtgaaagaaagggcaatatcttgcatgggtcaaatcatttgtagcctt
ggtgacagcttgggcacagacctgcctagtacacttcagatcttcctagagagactgaag
aatgaaatcactcggttaactacagtgaaggccatgacactgattgctggttctcctttg
aagatagatttgagaccaatcctgggggaaggagttcctattcttgcttcttttttgaga
aagaaccaacgggctttgaaactgggcactctttctgcattagatattttaattaagaat
tacagtgacagcttgacagctgccatgattgatgctgttctggatgagcttccacctctt
attagtgaaagtgatatgcacgtatcacagatggccatcagttttctaacaacacttgct
aaagtatatccttcctccttgtcaaagattagtgggtccattctcaatgaacttattggg
ctggtgagatcgcctctacttcagggcggagcacttagtgccatgctagaatttttccaa
gctttggttgtgactggtacaaataatctaggctatatggatttactgcgcatgttgacg
ggtccagtgtactcccagagcacagcacttactcacaagcagtcttattattccattgcc
aaatgtgtggctgcccttactcgagcgtgccctaaggagggaccagctgtggtaggtcag
ttcattcaagatgtcaagaactcaaggtccacggattccattcggcttttggctttgctt
tcacttggggaagttgggcatcacattgacttaagtggacaaattgagctgaagtctgta
atattagaagcattctcttctcctagtgaagaagtcaaatcagcagcatcttacgcatta
ggcagtattagtgttggcaatcttcctgagtatctgccttttgtcttacaagaaataacc
agccagcctaagaggcaataccttcttcttcattccttgaaagaaataattagctctgca
tcagtgattggtctcaaaccatatgttgagaacatctgggccttactcttgaaacactgc
gaatgtgcagaagagggtacaaggaatgttgttgctgaatgcttgggcaagcttacttta
atagacccagagactctgcttccacgactcaagggatacttggcatcaggatcctcatat
gctcgaagttctgtggtgactgctgttaagttcactatttctgatcatccacaacccata
gacccactcttgaagaactgcataggtgactttttgaaaacattggaagacccggatctc
aatgtcaggagagtagccctagtgacatttaactccgctgctcacaataaaccatcatta
ataagggacctcttagatactgtgcttcctcatctttacaatgaaacaaaagtcagaaag
gaattaatcagagaggtggaaatgggaccatttaagcacacagttgatgatgggttggac
attaggaaagctgcttttgagtgcatgtatactcttttggatagctgtttggatagacta
gatatatttgaattcctaaaccacgttgaagatggcttgaaggatcactatgacattaag
atgctaacctttttaatgttggtgagactgtctaccctttgtccaagtgcagtgctgcag
agattggataggcttgttgaacctttgcgcgctacatgtacaactaaggtaaaggcaaat
tcagtgaaacaggagtttgaaaagcaagatgaactgaaacgatctgcgatgagggcagta
gcagcacttctaaccattccagaagcagagaagagtccattaatgagtgaattccagtca
cagataagctctaacactgagctggcaaccatctttgaaagtatccaaaaagattcatca
tccactaacttggaatctatggacactagttaa

DBGET integrated database retrieval system