KEGG   Gallus gallus (chicken): 417845Help
Entry
417845            CDS       T01006                                 

Gene name
FRS2
Definition
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 417845
NCBI-ProteinID: NP_001186555
CGNC: 7573
Ensembl: ENSGALG00000009966
UniProt: E1C021
Position
1
AA seq 508 aa AA seqDB search
MGSCCSCPDKETVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEAPRTPRTPTTPGFNAQSLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRSSVHAPLESKLSNTETTKVKEDQMCTDDRDA
HVLLEPEGVKFVLGPTPVQRQLMEREKLEQLGRDQVSGSSTNNTEWDTGYDSDERRETPS
GNKLVYENINRLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
SRKLSRDEDDSLGPKTPSLNGYHNNLDPMHNYVNTENVTVPSSAHKIEFPRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSSLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagaaactgtcccagataaccatcgaaacaag
tttaaggttattaatgtggatgatgatggtaacgagctgggttctggcataatggaactt
acagatacagaactaattttgtacacccgtaaaagggactctgtaaaatggcactacctc
tgtctccgtcgctatggctacgactcgaatcttttctcttttgaaagtggtagaaggtgt
caaactggacaaggaatctttgcctttaaatgtgcccgtgcagaagagctatttaatatg
ttgcaagagataatgcagaataatagtataaatgtggtagaagaaccagtagtagaaagg
aataaccatcaaactgagttggaagctccaagaacccctcggacacctaccactcctggg
ttcaatgcacaaagtttacctaatggctatcccagatatccgtcttttggagatgcttca
tcacatccttccagcaggcatccttctgttggaagtgcacgcctcccctctgttggtgaa
gaatcaacgcatcctctacttgtagcagaggagcaagtgcacacttatgtcaacactact
ggcgtacaggaggaaagaaaaaatcgatcgagtgtgcatgcgccactggaatcaaagctt
tcaaacactgaaacaactaaagtaaaggaagatcagatgtgtactgacgatagagatgct
cacgttctcctagagcctgaaggagtcaagtttgttttaggaccaacccctgttcaaagg
cagttaatggaaagagagaaactggagcaacttgggagagaccaagttagtggcagcagc
acaaacaatactgaatgggacactgggtacgacagtgatgaacgtagagaaacaccatct
ggtaataaattggtgtatgaaaatataaataggttatcaatccctagtgcctcaggggtc
aggagaggtcgtttgacatccaccagtacctcagatacccagaacattaacaactctgct
cagaggagaactgcgctgttgaactatgagaatttgccatccttgcctcctgtttgggaa
tcccgcaagctgagtagagatgaagatgacagtttaggaccaaagaccccgtctctgaat
ggctaccacaataacctagatccaatgcataattatgtcaatacagagaatgtaacagta
ccatcaagtgctcataaaatagaatttccacgacgtcgggactgtaccccaacagtcttt
aactttgacattagacgtccgagtttagaacacaggcagctcaactacatacaggttgac
ttggaaggtggtagtgactccgacaaccctcagactcccaaaacccccaccactccactt
ccgcaaactccaaccaggcgcacagagctgtatgctgtgatagacattgaaagaactgct
gctatgtcaagcctgcaaaaagcactgccccgagatgatggtacttctaggaaaactaga
cataacagtactgacctgcctatgtga

DBGET integrated database retrieval system