KEGG   Gallus gallus (chicken): 417865
Entry
417865            CDS       T01006                                 

Gene name
BBS10
Definition
(RefSeq) Bardet-Biedl syndrome 10 protein isoform X1
  KO
K19401  Bardet-Biedl syndrome 10 protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    417865 (BBS10)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    417865 (BBS10)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 417865
NCBI-ProteinID: XP_015138702
CGNC: 7792
Ensembl: ENSGALG00000033769
Position
1
AA seq 684 aa
MASRPGLQQEAAALAGAVRGALGPRGGRALLVRPDGRALLTRDGRRLLEALGLQPPTARV
MAACACRHQSATGDGAKTFVLLLAAVLGAMREGSPRRAARALPAFERRVLERAVARGLRP
HLRSAFPAGGPGEELEAAALEALLEAYLRGRLGPGERRAVTLLGCELCARCGARRPPALR
LLCGRFAQLHAAAAGLPLARSRVLPGVLLRRDFAAYCPAGGRLRAVLVTRCLRPVLTGPG
VECAVRSERQHRAALRWCGGRTEAVMEHLRSGGVRLLLSGVKQHEEVIFYAKLHGVSVVE
CLSSEEVALISEIAGISPYDPAGDSVQGEIAEAAVVTFCQPLLLGSQRYVHIGFSSAGAF
QPHCLVLCAPVDAINEQHAAALHGAFTMLLQLFRAVDQECGAEGESQNGASGVGSGYSPA
TETQVVTESIACGSSQVSEHQLGACRGETAAQSSDLALQESERPDGTPPASAPGPHSKEL
SVCTDGADSAGTHKLPALCECPDGMNESHRRQQAVCSHRNYCTAVASTATLCEHLGVGKG
PEKAGYGVTQSCPSSILEAGSVLPVGGYFEILLHYYIQHYAKQVQQSAVTAISNVVADAL
LSIPKALYGTERNGFTKFYLETTEALRKNQPLPVNEKGLESVYCKYQLVTSVLHCVTELL
NIDLIIGVKRPLQKIEDKDSDDDF
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggcgtcgcggcccgggctgcagcaggaggcggccgcgctggcgggcgcggtgcgcgga
gcgctggggccgcggggcgggcgggcgctgctggtgcgacccgacgggcgggccctgctg
acgcgggacgggcgacgcctgctggaggcgctcggcctgcagccgcccacggccagggtg
atggcggcctgcgcctgccgccaccaaagcgcgacgggggacggcgccaagacgttcgtg
ctgctgctggccgccgtgctgggcgcgatgcgggagggctccccgcggcgggcggcgcgg
gcgctgccggccttcgagcggcgagtgctggagcgcgccgtggcgcggggcctgcggccg
cacctccgcagcgccttccccgcgggcgggccgggggaggagctggaggcggcggcgctg
gaggcgctgctggaggcctacctgcggggccggctggggccgggcgagcggcgcgccgtg
acgctgctgggctgcgagctgtgcgcccgctgcggggcccgccgcccgcccgcgctgcgc
ctcctctgcggccgcttcgcgcagctgcacgctgctgccgccgggctgcccctcgcccgc
tccagggtcctgcccggcgtcctgctccgcagggacttcgccgcctactgcccggccggc
ggccggctgcgcgccgtgctggttacccgctgcctgcggcccgtgctcacgggccccggc
gtggagtgcgcggtgcgctccgagcggcagcaccgggccgcgctgcgctggtgcggcggg
agaaccgaggctgtgatggagcacctgcggagcggcggcgtgaggctgctgctgtccggc
gtgaagcagcacgaggaagttatcttctacgcgaaattacacggtgtgtccgtggtggag
tgtttgtcatcggaagaagtggccctcatctctgagatcgcaggaatctcgccctatgac
cctgccggtgatagcgtacagggggagatcgcagaggccgcagtggtaaccttctgccag
cccctgctgctgggctcccagcggtacgtacacattggcttcagcagtgcgggcgccttc
cagccccactgcctggttctgtgcgctcccgtggatgccattaatgagcagcacgctgcc
gctctgcatggggccttcaccatgctgctgcagctcttcagagcggtggatcaggagtgt
ggagctgagggtgagagccagaacggtgcctcaggtgttgggagcgggtattctccagct
actgagacgcaggtggtaacagaaagtattgcttgtggcagcagtcaggtttctgagcat
cagctgggagcctgcaggggtgaaacggcagcacaaagttcagatcttgctttgcaggaa
agcgaacgtcctgatggtacaccaccagcctcagctcctggcccacacagcaaggagctg
agcgtctgcaccgatggggctgactcagcagggacacacaaactgcccgcgctgtgtgag
tgtccagatgggatgaacgagagccaccgaaggcaacaggcagtgtgcagtcacaggaat
tactgcactgctgtagccagcactgctaccctgtgtgagcacctaggtgtcggtaaaggc
ccagagaaggctggctatggtgttacacagagttgtcccagctccatcctagaagcggga
tcagttctgccggtaggaggttactttgaaatcctgttacattattatattcagcattat
gcaaagcaggttcagcagtcagcggttactgccatatctaatgtagttgctgatgctttg
ttaagtattccaaaggccttatacggaacggagcggaatggctttaccaagttttatctt
gaaaccacagaagcactcaggaagaatcagcccctgcctgtgaatgagaaaggcttggag
tcagtttattgcaaataccagctggtaacgtcagttcttcattgtgttacagagcttctc
aatattgatttaatcattggtgttaagcggccactgcagaaaattgaggataaggattcg
gatgatgatttctga

DBGET integrated database retrieval system