KEGG   Gallus gallus (chicken): 417873Help
Entry
417873            CDS       T01006                                 

Gene name
MYF6
Definition
(RefSeq) myogenic factor 6
  KO
K18485  myogenic factor 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    417873 (MYF6)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    417873 (MYF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Basic HLH Myf5
Motif
Other DBs
NCBI-GeneID: 417873
NCBI-ProteinID: NP_001025917
CGNC: 50612
Ensembl: ENSGALG00000010936
UniProt: Q01795 C4P6Q1
Position
1
AA seq 242 aa AA seqDB search
MMMDLFETGSYFFYLDGENGALQQLEMAEGSPLYPGSDGTLSPCQDQLPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQDKMQEVAADPFSFSPKQGNVPGSDFL
STCGSDWHSASDHSRALGGSPKAGGSMVESSASSSLRCLSSIVDSISSDEPKLPGAEEAV
EK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggaccttttcgaaaccggctcctatttcttctacttggacggggagaatggg
gccctgcagcagctggagatggcagagggctcgccgctgtacccgggcagcgacggcacc
ctgtccccgtgtcaggaccaactgccgccggaggccggcagcgacagcagcggcgaggag
cacgtgctggccccgccgggcctgcagcccccgcactgccccggccagtgcctcatctgg
gcctgcaaaacctgcaagagaaagtcggcccccaccgaccggcggaaagcggccacgctg
cgggagcggaggaggctgaagaagatcaacgaagccttcgaggctctgaaaaggcggact
gtggccaaccccaaccagcggctgcccaaggtggagatcctgaggagcgccatcagctac
atcgagaggctgcaggacctgctgcacaggctggatcagcaggacaaaatgcaggaggtg
gcggcggaccccttcagcttcagccccaagcagggaaacgtccccggctccgacttcctg
agcacctgcggctccgactggcacagcgcttccgaccattcccgcgcgctggggggcagc
cccaaagcagggggctccatggtggagtcgtcggcctccagcagcctgcgctgcctctcc
tccatcgtggacagcatttcctccgacgagcccaagctgcccggcgcggaagaggcggtg
gagaaatga

DBGET integrated database retrieval system