KEGG   Gallus gallus (chicken): 417901
Entry
417901            CDS       T01006                                 

Gene name
PLXNC1
Definition
(RefSeq) plexin-C1
  KO
K06572  plexin C
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    417901 (PLXNC1)
CD molecules [BR:gga04090]
 Proteins
  417901 (PLXNC1)
SSDB
Motif
Pfam: Plexin_cytopl TIG PSI Sema
Other DBs
NCBI-GeneID: 417901
NCBI-ProteinID: XP_015139558
CGNC: 8596
Ensembl: ENSGALG00000011309
Position
1
AA seq 1501 aa
MAAPPALSWALPLLAALAGAGGHRSFELPGAPIDNIEVSGRFVLVAGGGCLYEVRSDLSR
SRRVVPPGGPGCREPSGVRSKLLLLTHAEAGVDGQLLAGWTQGQGSCEVWRLPDYRLVLN
RTEVVSCLPRGSTAGVVFRQADDWYLAVAATYSNGERWPPAGCEPSESSQTAAITVRPVK
TLEPRGEWDIIKYNKEPLHFVDALWWGGRLFFPYYRLKAELDRDPELPSMVVMHQPHRSE
HSFDLQGQVYLDCGCRSLLISSSLVRQGERGWWVGVFRHNHGDRAWDSTAVCVFGMEELR
EPTCVYSTHFYAGTNCKVQSIKKSPTLIHSGLVAVYGTVVLNQIVLFLGTDDGQLLKAIL
NEDMKSNCPEILYEIEEETSIFPKLRLDPVDSNYIYLSSANKVRRIPVANCGRYVSEQEC
LSAKDPYCGWCSLNQRCTLKENCTRSNSTKGWFNISHAPDKDLKILLRFPARNQISVSAS
ISKTLTSCRIKIVKPIEMPHENVVLKNSSCVCNLTTPVTLDNDCLVLEASLSSSSWNLTE
TFQLENCSWCIHDGECASCNWTRVSPATACQDICSVQNASKDITTAQKSEHINIHSIKPL
WISTLGKSEITVKGENFTHESGIKLILTGSSVCKQEIIKVRNVINDTQMTFALPPTRKEA
KSVCIQADGRKCSPPVTLHYVSLPACFGITPNTSWISGGRKIITTGRNLNVVDKVIISDD
QRSNLTISECPQNKSEYHYLSPSLSHATEGKVVDMIFKVETTFIPCVKLHYHPDPVFINY
QLHTELDPDLELKIYKENDNLNISKTEVEVYLSYMNGSQTAKIYFSVQNITEKPDRSTIL
CKFKREGTEKIDFSTVKVFVKLGNFELEVKPTSSYIYLYVLILLPIVVGVIIVAFIVTRY
KSKELTRKQSQQLELLEYEIRKEIREGFAELQMDELDVVDSFGTVPFLDYKHFAIRTFFP
ESGGFASIFSEDMPQSRDQTRKDESFNMLHALICNKNFLVTLIHTLEKQKNFSVKDRCLF
ASFLTIALQTKLVYLTHILEVLTKDLMEQSSNVQPKLLLRRTESVVEKLLTNWMSVCLSG
FLRETIGEPFYLLVTTLNQKINKGPVDAITCKALYTLNEDWLLWQVSEFKTVTVNVIFEK
IPENESGDACQTIQVNVLDCDTIGQTKEKSLQAFLNKNGFPYGLQLDEIGLELVSEEQQR
ELLDIDGSSEMMEDGIRKLNTIAHYKIANGATIKVLKKKTNTRSDVDYSDEHCHLILPDS
EANKDMKGSGHKGKQKFKVKEMYLTKLLSTKVAIHSVVENLFRSIWSLPNNKAPVAIKYF
FDFLDAQAESKRITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDVKKTSHIDGCLSVIAQ
AFMDAFSLAEQTMGKEAPTNKLLYAKDIPLYKKEVKAYYKAIRDLPPLTTSEVEEFLTQE
SKKHENEFNEEVALMEIYRYIVKYYDEIVSKLERERGFEEVQKQLQQVKALFDEKKKCKW
V
NT seq 4506 nt   +upstreamnt  +downstreamnt
atggcggcgccgcccgcgctcagctgggcgctgcccctcctggcggcgctggcgggcgcc
ggcggccaccgctccttcgagctgccgggggcccccatcgacaacatcgaggtgagcggc
cgcttcgtgctggtggcgggcggcggatgcctctacgaggtgcggtccgacctttcgcgg
tctcgccgcgtggtgccgccgggcgggccgggctgccgggagccctcgggcgtgcggagc
aagctgctgctgctcacccacgccgaggccggagtcgacggacagctgctggccggctgg
acgcaggggcagggcagctgcgaggtgtggcggctgccggactaccgcctggtcctcaac
cgcacggaggtggtcagctgcctgccccgcggctccacggccggagtggtcttccggcag
gcggacgactggtacctggcggtggcggccacctactccaacggcgagcgatggcccccc
gcgggctgcgagccgtcggagtcgagccagacggcggcgattaccgtgcgccccgtaaag
accctggagcctcgcggagagtgggacatcatcaagtacaacaaggagcctttgcatttc
gtggacgcgctgtggtggggtggccgcctcttctttccctactaccggctgaaggccgag
ctggacagggacccggagctgccgagcatggtggtcatgcatcagccgcatcgctccgag
cacagctttgacctccaaggccaagtgtatctggactgtggttgcaggagcctcctcatc
tcctccagcctcgtccgccaaggagagcggggctggtgggtgggcgtcttccgccacaac
cacggtgacagggcctgggactccaccgccgtctgcgtcttcgggatggaggagctgcgg
gagccaacctgtgtgtacagcacacacttctacgcggggaccaactgcaaggtacaatca
atcaagaaatcacccaccttgattcactctggattagtggctgtttatggcacagttgtt
ttaaatcagatcgttctctttctgggaacagatgatggacagttactgaaggctattctt
aatgaggatatgaaatctaactgcccagagattttgtatgaaattgaggaagaaacctct
atttttcccaaacttcgacttgatccagtagatagtaactacatctatctgtcctctgcc
aacaaggtgagaagaataccagttgcaaattgtggtagatatgtttccgagcaagaatgc
ttatctgcaaaggatccctactgtgggtggtgttctttgaatcaaaggtgcacattaaaa
gagaattgtacacgttcaaacagcacaaagggttggtttaacatttcacatgcacctgat
aaagatctgaaaatcctgctaaggttccctgccagaaatcagatttctgtgtctgcaagt
ataagcaaaacccttacttcctgtagaataaaaattgtaaaacctattgaaatgcctcat
gaaaatgtagtgctgaaaaactcatcctgtgtctgcaatctcactactccggtgacactg
gataatgattgtctggtccttgaagcatcgctgtcttcaagctcttggaatctcacagaa
acatttcagttggaaaactgttcatggtgcatacacgacggtgagtgtgccagctgtaac
tggacacgtgtctctcctgccactgcctgccaggatatttgcagtgtccaaaatgcttcc
aaggatatcaccacagcgcagaaatcagagcatatcaacattcattccatcaagcctttg
tggatttctacgttgggcaaaagtgaaataacagtcaaaggagaaaactttacacatgaa
tcgggcataaaactgatactgacaggaagcagtgtctgtaaacaagaaatcattaaagtt
agaaatgtgataaatgatacacagatgacatttgctctcccaccaacacgtaaagaggcc
aaaagtgtatgcatacaggctgatgggagaaaatgttcaccaccagtcaccctgcattat
gtttcactgccagcatgttttggaatcacaccaaatacctcctggatcagtggtggtcgc
aaaataattacaactggtagaaatttgaatgtggtggacaaagtgattatttcagatgac
cagagatcaaacctcaccatctctgagtgtcctcaaaacaaatctgagtatcattactta
tcgccaagtctgagccatgcaacggagggtaaagttgttgatatgatatttaaagtggaa
actacctttataccatgtgtcaaattgcactatcaccctgacccagtgttcattaactat
cagctgcacactgagctggatcctgatctggaattaaaaatatataaagaaaatgacaac
ttgaatatttctaaaactgaggtagaagtttatctgtcatatatgaatggttcacagact
gcaaagatatacttcagtgtccaaaatattactgaaaagccagaccgtagcaccatactg
tgcaaattcaaaagggaaggaacagaaaagattgacttttccacagtgaaagtttttgtc
aaattaggaaattttgagcttgaagtcaaaccaacgtcatcatacatatatttatatgtc
ctcattttgctacctattgtagtgggtgtcataatagtggcattcatagttactagatac
aagtccaaggagttaactcgtaaacagagtcagcaacttgaattgttggagtatgaaatt
cggaaagaaatacgcgagggatttgctgaactgcagatggatgaattagatgtggtggat
agttttggaactgttcctttccttgactacaaacactttgctattagaactttctttccg
gagtcaggaggttttgcatccatcttcagtgaagacatgccacagagcagagaccaaaca
cgcaaggatgaaagcttcaacatgttgcatgctctgatttgtaacaagaactttcttgtt
actctcattcacactcttgaaaagcagaaaaatttctctgtgaaagacaggtgcttgttt
gcatccttcttgactattgcactacaaactaagctagtttatctaacccatattttggaa
gtgttgacgaaggacttgatggaacagtcaagcaatgtgcagcctaaactcctgctcaga
cgaactgaatctgtggtagaaaaattgctgacaaactggatgtctgtctgcctttctggg
tttctccgggagacaattggtgaacctttctatttgctagtgacaaccctcaatcagaag
ataaacaaaggacctgttgatgcaataacttgcaaagccctgtacacgcttaacgaagac
tggctgctgtggcaagtgtctgaattcaaaacagtgactgtgaatgtaatctttgaaaaa
atcccagaaaatgagagtggagatgcctgtcaaactattcaagttaacgtgctggactgt
gacaccataggccaaaccaaggagaagagccttcaagctttccttaataagaatggcttt
ccctatggtcttcagctggatgaaattggccttgaacttgtgtctgaggagcagcaaaga
gaactgttagatattgacggttcctctgagatgatggaggatgggataaggaagctaaat
accattgctcattacaagattgcaaatggagcaaccataaaagtcttgaaaaagaagaca
aatacccgatcagatgtggactactctgacgagcactgtcatttgattttacctgactct
gaagcaaataaagacatgaaaggatcgggtcacaaaggaaagcaaaaattcaaagtgaaa
gaaatgtatctgacaaagctactgtcaaccaaggttgcaattcattccgttgtcgaaaat
ctcttccggagtatttggagtctacctaacaataaagctcctgttgccatcaagtatttt
tttgactttctggatgcccaggccgagagcaaaagaatcactgaccccgatgtggttcac
atatggaaaaccaacagtcttcctctgcgcttctgggtgaacatactgaagaatccccag
tttgtctttgatgttaagaagacgtcacatatagatggctgtttgtctgtcatcgcacaa
gctttcatggatgccttttctctagcagaacagacaatggggaaggaagcaccaacaaac
aagcttctctacgctaaggacattccgctctacaagaaggaggtgaaggcgtactacaaa
gccatcagggatctgcctcccttgaccacttcagaggttgaagaatttctaactcaggaa
tctaagaaacatgaaaatgaatttaatgaggaagtggccttgatggaaatctacagatac
attgtgaagtattacgatgagattgtcagcaaactcgagcgagaacgggggtttgaagaa
gtccagaaacagctccagcaagtaaaagccttattcgatgaaaagaagaaatgcaaatgg
gtttga

DBGET integrated database retrieval system