KEGG   Gallus gallus (chicken): 417919
Entry
417919            CDS       T01006                                 

Gene name
ELK3
Definition
(RefSeq) ETS domain-containing protein Elk-3
  KO
K09430  ETS domain-containing protein Elk-3 (SRF accessory protein 2)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    417919 (ELK3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    417919 (ELK3)
SSDB
Motif
Pfam: Ets Translat_reg HSF_DNA-bind
Other DBs
NCBI-GeneID: 417919
NCBI-ProteinID: NP_001025920
CGNC: 8690
Ensembl: ENSGALG00000043701
UniProt: Q5ZMM7
Position
1
AA seq 407 aa
MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLS
RALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKMATESRD
VHKHSLSALKSTSRNEYIHSGLYSSFTINSLQNQPDTYKPIKTEKLEEKSEGNTPVEEVR
TVIRFVTNKTDKQVMRPMVSLPSTSETAAASAFLSSPVSAKISSLMLPNSASISSPSSSS
SRSPSLSPTSPLPSEHRSLFFESSCHDSDSLEPLNLSSGSKAKSPSLPPKAKKPKGLEIS
APPLVLSSTDIGSIALNSPALPSGSLTPAFFTAQTPSGLLLTPSPLLSSIHFWSSLSPVA
PLSPARLQGPNTLFQFPTLLNGHIPVPLPSLDGASSPVLLSPNAQKS
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggagagtgcaatcacactgtggcagttccttttgcagttgctgctagaccagaaacat
gagcacctgatttgctggacatctaatgatggcgaattcaagctactcaaggcagaagaa
gtggctaagctgtggggactcagaaaaaacaaaactaatatgaactatgacaagctgagc
cgagcgctcagatactattatgacaagaacatcatcaagaaggtgattggacaaaaattt
gtgtacaagtttgtgtccttccctgagattttaaagatggatccacacgccgtggaaatc
agcagagagagccttttgctgcaggacagcgactgtaagatggccaccgagagcagggac
gtgcacaagcacagcttgtcggcactgaaaagcacgagccgcaacgagtacatccactcc
ggcctgtattcctccttcaccatcaactctctgcagaaccagccagacacttacaagcca
atcaaaacagaaaaactggaggagaagtcagaaggaaacactccggttgaggaagtgcgg
actgttataagatttgtgacaaacaaaacagacaaacaagtcatgaggcccatggtgtcg
ttgccttccacctccgaaacagcagctgcctctgcttttctcagctcacccgtatcagcc
aaaatctcttccttaatgctacccaacagtgccagcatctcatctccatcatcatcctcc
tccaggtcgccgtcgctgtctcccacttctcccctcccctcggagcacaggagcctcttc
tttgagtccagttgccacgactcagattccctcgagccgctgaacctctcctcgggctcc
aaggcaaagtcgccatctcttcccccaaaggctaagaaacccaaaggcttggaaatctca
gccccacctttggttctttccagcaccgatatcggttccattgccctcaacagccctgcc
cttccttcaggatctctgactccagccttcttcactgcacagaccccaagtggattattg
ctgaccccgagcccgctgctgtccagcatccatttctggagcagcctcagccccgttgct
cctctgagtcctgccaggctgcagggacccaacactctgttccagtttccgactctgctc
aatggtcacatcccagtgccactccccagtctggacggagcctcttctccagtactgctt
tcaccgaacgcccagaaatcctga

DBGET integrated database retrieval system