KEGG   Gallus gallus (chicken): 417974Help
Entry
417974            CDS       T01006                                 

Gene name
POLDIP3
Definition
(RefSeq) polymerase delta-interacting protein 3
  KO
K22414  polymerase delta-interacting protein 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    417974 (POLDIP3)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     417974 (POLDIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 417974
NCBI-ProteinID: NP_001012832
CGNC: 8993
Ensembl: ENSGALG00000011863
UniProt: Q5F4B6
Position
1
AA seq 418 aa AA seqDB search
MADLSLDELIRKRGVTVKGRLNTRPVFGGIRSRIGIQQNILSRSSPAVNFQRTFDARQKI
GLTDARHKLGVKDAREKLIQRDARFKIKGKVQDAREMLNSRKQQSVAAEKVTKVVDAREK
ISLKRNTPAAISPTMGTVNPAVKITKTIQQKAPVVPGHPHPAGMRINVVNNHTHKQGLYD
VEDDDESVSPLPSKQMKITTTNSFLHNVAGLSGNKFSLSKTVPLTKVVQNDTYTAPPAPP
SPMRTKALTNMSRTLVTKEEPPKEPAPVELAFSPLEGTKMTVNNLHPRVTEEDIVELFCV
CGALKRARLVHPGVAEVVFVKKEDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPIL
LRLSDTPSVKKEGEPRRSSASAASNPPAEVDPDTILKALFKSSGVSASVQPTEFKIKL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctgtcgttagacgagctcatacggaagcgcggtgtgacggtgaaggggagg
cttaacacaaggccagtatttggaggtattagatctcgcattgggatccagcagaatatt
ttaagtagatcatcaccagctgtcaacttccagcggacgtttgatgctcgacagaagatt
ggcctcactgatgcccgacacaaactgggagttaaagacgctcgtgaaaaactgattcaa
agggacgctcggttcaaaataaaagggaaggtgcaggatgctcgggagatgttgaattcc
cgtaagcagcaaagtgttgctgctgaaaaggtgaccaaagtggtagacgccagagagaag
atcagtttaaaaaggaacactccagctgctatcagcccaactatggggacagtaaatcca
gctgtgaaaatcaccaagactatccaacagaaggctcccgttgttcctggacaccctcat
ccagcaggaatgaggatcaatgtggtgaacaaccatacacataaacagggtctgtatgac
gtggaagatgatgatgaaagtgtctctccccttcctagcaaacagatgaagatcaccacc
acaaacagtttccttcacaatgtggctgggctgagtggcaataagttctctctgtccaag
actgttcccctgactaaagtggtccagaatgatacgtacacagctcctcctgcacctcct
tccccaatgaggacaaaggccttgacaaacatgtcccgaaccttggtgacaaaggaggag
cctccaaaagagccagcacctgttgagctggccttcagtcctttggaaggtacaaagatg
actgtaaacaatctgcatcctcgagtcactgaggaagacattgttgagttgttctgtgtg
tgcggtgctctgaagcgagcccggctggtgcacccaggagtggctgaggtagtctttgtg
aagaaagaagatgcaatcacagcatataagaaatacaacaacagatgcttagatggtcag
ccaatgaaatgtaaccttcatatgaatggaaatgtcatcacctcagaccagcctatattg
ctccgattgagcgataccccttctgtgaagaaggaaggggaaccccgccggtcaagtgca
agtgctgcgtcaaatcccccagctgaggtggaccctgataccatcttgaaggcactcttc
aaatcctcaggggtctctgcatctgtgcagcccacagaattcaaaatcaaactctga

DBGET integrated database retrieval system