KEGG   Gallus gallus (chicken): 417980Help
Entry
417980            CDS       T01006                                 

Gene name
TCF20
Definition
(RefSeq) transcription factor 20 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 417980
NCBI-ProteinID: XP_004937744
CGNC: 9003
Ensembl: ENSGALG00000011878
UniProt: E1BXI6
Position
1
AA seq 1941 aa AA seqDB search
MQSFREQSSYHGNQQSYPQEVHGSSRLEEFSPRQQAQMFQSFGGGTGSGRRGAAGASTAM
PGESSGHQSYQGFRKEAGEFYYMATNKDPVASGGQQPPQRRPSGPVQSYGPPQGSSFGSQ
YGSEGHVGQFQTQHSTLGGVSHYQQDYTGPFSPGSAQYQQQASSQQQQVQQLRQQIYQSH
QPLPQASSQSASSTSHLQPMQRPSTLPSSASGYQLRVGQYSQHYQPPSSSSSSSFPSPQR
FGQSGQNYDGSYSVNSGSQYEGHAVGSTAQAYGSQSNYSFQSQPMKSFEQSKLPQSGQQG
QQQQQHPPQHVMQYSNAASKLSLQSQVGQYSQTEVPVRSPMQFHQNFSPISNPSPAASVV
QSPSCSSTPSPLMPGGENLQCGQGNMSMGSRNRILQMMPQLSPTPSMMPSPNAHAGGFKG
FGLEGLQEKRLTDPGLSSLSALSSQVANLPNTVQHMLLSDALAPQKKSSKRSSSSKKADS
CTNSEGSSQAEEQLKSPLAESLDGGCSSSSEDHGERVRQLSGQSTSSDTTYKGGNLERSN
SSPAQGSQSEPSKLSTSPAAREDVASPDGKEAVVAVENAPKVNEKAVGVIVSREAMAGRV
EKSGGQEKPAQDDVSTATQTPISASGAKEAGHAGPQPEAQGGTKGSKSGDNTNHNGEGNS
QPSNAVVGSNFPVRTEPSKSPGSLRYSYKDNIAAGIQRNIGGFPQYPSGQEKGDFPGHSE
RKGRNEKFPSLLQEVLQGYHHHPDRRYSRNAQEHSGMAGSLEGAMRPNILISQANELTNR
GLLNKSMGSLLEGPHWGPWDRKSSSAAPDMKQINLADYPIARKFEMESQSSSHEGGALSE
RRSVICDISPLRQLVRDPGPHPMGHMGPEGRSGRSERLAPGLSQSVILPGGLVSMETKMK
AHSGQIKEEEFEQSKSSVSLNNKKTGDHCHSAGIKHESFRGNASPGAAVSDSAPDYIPQQ
ESRSTQLRRAPGRTGSSRGKSPSQFQDLADKLKMSPGRSRGPGADLHHMNPHMTLSERVN
RGSLHSGYPQNSEGSSLAAAYHANARPHPFGDPNQSLNSQYHYKRQLYQQQQEEYKDWAS
SAAQGVIAAAQHRQEGARKSPRQQQFLDRVRSPLKNDKDGMMYLQGSSYHDTGSQDPGRC
IMGSDSAQGKCIDLKHGNQKLQPHESGWDLSRQTSPAKSSGPLGAANQKRFCPQESDGHR
REESTDLPKPSNAMLRLPGHEDQSPQNPLIMRRRVRSFISPIPTKRQPQDMKNSGSEDKG
RMMTSAKEGADKTYNSYAHSSQSQDVGKPVAKGDSFKDLPSPDGRNCPAVSLTSPAKTKI
LPPRKGRGLKLEAIVQKITSPNIRRSVSTNSAETGADTVTLDDILSLKSGPEGGSVSAHG
PEAEKRKGEMLSDQAGSASQDAASEITLARSSEEWQGNEDDKTKKDTPENASVSKEGTGS
SAAPPPQKSGGQGRSDGSISGAGTLAFPDSKTVSPSIVFTSEPNPKSEEKDGDVTNISPK
PDGFPPKGYFPSGKKKGRPIGSVNKQKKQQQQQQQLPPPPPPPPVPSQSSEGVAGGEPKP
KRQRRERRKPAAQPRKRKPRRAAPIVEPQEPEIKLKYATQAVDKTDSKNKSFFPYIHVVN
KCELGAVCTIINAEEEEQNKLVRGRKGQRSSTPPPSNVESKVLPTSTFMLQGPVVTESSV
LGHLVCCLCGKWASYRNMGDLFGPFYPQDYAATLPKNPPPKRATEMQSKVKVRHKSASNG
SKTDTEEEEEQQQQKEQRSLAAHPRFKRRHRSEDCSGASRSLSRGASCKKATTEGGSGGE
KTPLDSKPSMPTSEGGTELELQIPELPLDSNEFWVHEGCILWANGIYLVCGRLYGLQEAV
EIAREMKCSHCQEPGATLGCYNKGCSFRYHYPCAIDADCLLNEENFSVRCPKHKPLLPCS
LPSLQNKMVKGSLSTEQSERG
NT seq 5826 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctttcgggagcaaagtagttaccacggaaaccagcagagctacccgcaggaa
gtgcacggatcatcccgactggaggagttcagcccgcgccagcaggcccagatgttccag
agcttcggaggaggtactggcagtggacgtcgcggagcagcaggagcctctacagcgatg
cctggtgagagctctggccatcagagctaccaaggtttcagaaaagaagcaggagagttt
tactatatggctaccaacaaagatccagtggcgtcaggagggcagcagccgcctcagcgc
aggccttctggaccggtacagagctatgggccccctcaagggagtagctttgggagtcag
tatgggagtgagggacacgtgggccaatttcaaacacagcattcgacccttgggggcgta
tcccactatcagcaggattatactggtcctttctctccagggagtgctcagtatcagcag
caggcttctagccagcagcagcaggtacaacagctgagacagcagatctatcagtctcat
cagcctttaccccaggcttccagccagtctgcttctagcacctcgcacttgcagccaatg
cagcgtccatccaccctgccttcctctgcttctgggtaccagttacgagtgggtcagtac
agccaacactatcagccaccttcgtcgtcctcgtcctcctctttcccttccccacagcgt
tttggccagtcaggacagaattatgatggaagctacagcgtgaattctgggtcacagtat
gaaggccatgccgtgggttccactgcacaggcatatgggtcccagtcaaactacagcttt
cagagtcaaccaatgaaaagctttgagcagtctaagctgccccaaagtgggcagcagggg
cagcagcagcagcagcacccacctcagcatgtaatgcagtattcaaatgctgcctccaag
ctctctcttcaaagtcaagtgggacagtacagccagactgaagttcctgtaaggtcaccg
atgcagtttcaccaaaacttcagtccaatctctaatccatctcctgctgcatctgtggtt
cagtctccaagctgcagctccaccccttctcctctcatgccgggtggagaaaatctccag
tgtgggcaaggcaacatgtctatgggttctagaaaccgaatcctgcagatgatgcctcag
cttagtcctacaccatctatgatgccaagtcccaatgctcatgcagggggattcaagggg
tttgggctggaaggactgcaggaaaagaggctcacagatccagggctgagtagcctgagt
gccctaagttctcaagtggccaatctgcccaacacagtccagcacatgttgctttcagat
gccttggcacctcagaaaaaaagttccaaaaggtcatcctcttcaaagaaggctgacagc
tgcacaaactcagaaggctcttcccaggcagaggagcagctcaagtcccccctggcagag
tccctcgatggtggctgttccagtagttcagaggatcatggggaaagggtgagacagctg
agtggccagagcacaagctcagacactacctacaaggggggtaacttagaaagatccaac
tcctcaccagcacaaggctctcagagtgagccctcaaaactcagcaccagccctgcagct
agggaagatgtggcctcccctgatgggaaggaagctgtggtggcagtggaaaatgcccca
aaagtgaatgaaaaggcagttggagtgattgtctcccgggaggctatggcaggtagagta
gaaaagtcaggtggacaagagaaacctgcacaggatgatgtttccacagccactcagaca
ccaattagtgctagcggagcaaaggaagctgggcacgcagggccacagccagaagctcaa
ggaggtactaaggggagcaaaagtggagataacactaaccataatggagaggggaacagc
cagcccagcaatgcggttgttgggtcaaattttcctgtgagaacagaaccttccaaatct
ccaggcagtttaagatacagttacaaagataatatagcagctggcatacagagaaacatt
ggtggttttccacagtatccttctggtcaagaaaaaggggattttccaggacacagtgag
cgcaaagggaggaatgagaagtttcctagcctcctacaggaggtcttacagggttaccac
catcatccagacagaaggtattctaggaatgcacaggaacattctgggatggctgggagt
ttggagggagccatgaggcccaatatcttaattagtcaagccaatgaattgacgaataga
ggcctcttaaataaaagtatggggtctctcctggaaggccctcactggggtccctgggat
aggaagtctagcagcgcagcccctgacatgaagcagataaatttagctgattatcctatt
gctagaaagtttgaaatggaatctcagtcttcttctcatgaagggggagcgctctcggag
aggagatcagtgatctgtgacatatctccattaaggcaacttgtcagagatcctggtcct
cacccaatggggcacatgggtcctgagggcagaagtggaaggagtgaacgtcttgcccct
ggcttaagccagtcagtaatactccctggtggtttagtatccatggaaacaaagatgaaa
gctcacagtgggcaaataaaagaagaagagtttgaacagtcaaagagctcagttagtctt
aataataaaaagacaggagaccattgtcattctgctggcatcaagcatgagtctttccga
ggcaatgctagccctggagctgcagtctccgattctgctccagactacattccccagcag
gagagcagatcaacacagctgagacgagcacctggcagaactggaagcagcaggggtaaa
tcaccttctcaatttcaggatcttgctgataagctgaaaatgtcaccgggcagaagcaga
ggcccaggagcagatctgcatcacatgaacccacacatgacgctatctgaaagagttaac
aggggttccttgcattctggctaccctcagaactcagaaggctcatctttggctgcagca
tatcatgcaaatgctaggcctcatccttttggtgaccccaaccagagcttaaattcccag
tatcattacaagagacagctataccagcaacagcaagaagaatacaaagattgggcaagc
agcgctgctcagggtgtgattgctgcagctcagcacagacaggaaggagccaggaagagc
ccaagacaacagcagtttttggacagagtaaggagtcccttgaaaaatgacaaggatgga
atgatgtaccttcagggtagctcttaccacgatactggaagccaggatcctgggcgctgc
attatgggaagcgacagcgcacagggtaagtgcattgacctaaaacacggaaaccagaag
ctgcagccgcatgagtctggttgggacctctctcggcagacttcacctgccaaaagcagt
ggccctcttggagcagccaaccaaaaaagattttgcccccaagaaagcgatgggcacaga
cgagaggaatctacggatttgcccaagcctagcaatgccatgctcaggctccctggccat
gaagaccagtctcctcagaatcccttaattatgaggaggagagtccgttctttcatctct
cctatccctaccaaaagacagccacaggatatgaagaacagtggcagtgaagataaaggg
cgaatgatgacgtcagcaaaagaaggagctgataaaacatacaactcctatgcccattca
tctcaaagccaagatgttggcaaaccagttgcaaagggagattccttcaaggatctgcca
agtcctgatggtaggaattgtcccgctgtttccctcacaagcccggctaagaccaaaata
ttgcccccaagaaaggggcgaggattaaaactggaagcaattgttcaaaaaattacatct
cccaatattcggagaagtgtttccaccaacagtgctgaaactggtgcagatactgtcact
cttgatgacatcctgtcccttaagagtggacctgagggagggagtgtgtctgcacatggg
ccggaggctgagaagaggaaaggagagatgttgtcagatcaagcagggtcagcaagccag
gatgcagctagtgaaataactcttgcgcgatcctcagaagagtggcaaggcaacgaggat
gataaaaccaagaaagacactcctgaaaatgccagtgttagtaaagaagggacaggatcc
agtgcagcaccacctcctcagaagtcaggtggtcaggggaggtctgatggatccataagc
ggagccggaactctggcctttccagactcaaaaacagtttccccttccattgtgtttact
tctgaaccaaacccaaagtctgaggaaaaagatggagatgtgacaaacatttcacccaag
ccagatggcttccctccaaagggatattttccttctggaaagaaaaaggggagaccaatt
gggagcgtgaacaagcaaaagaagcaacagcagcagcaacaacaactgccaccgccccca
ccacctccacctgtaccttctcagtcttcggaaggggttgctggtggtgagccaaaacct
aagaggcaaaggagggagaggcgaaaacctgcagctcagccacggaagcggaagcctaga
cgggctgctccgattgtggagcctcaagaaccagagatcaagcttaaatacgctacccag
gctgtggataaaactgactccaagaataaatcctttttcccttacattcacgtggtaaac
aagtgtgaattaggagctgtgtgcacaatcattaatgcggaggaagaggagcagaacaaa
ttggtgaggggtcggaaaggacaaaggtcttcaacaccccctcctagcaatgtggagagc
aaagtgctgcccacctcaactttcatgctgcagggccctgtagtaacagagtcttctgtc
ttggggcatctggtttgctgcctgtgtggcaaatgggccagctatcgtaacatgggtgac
ctctttggtcctttctacccccaggattatgcagccaccttgcccaagaacccacctcca
aagagggccacagaaatgcagagcaaggtcaaggtacggcacaaaagtgcttctaatggt
tccaagacagatacagaggaggaggaggaacagcaacaacagaaggaacaaagaagccta
gctgctcatccccgctttaagaggcggcaccgctctgaggactgtagtggagcctctcgg
tcactttcaaggggagcttcttgtaaaaaagcaaccactgaaggtggcagtggtggcgaa
aagactcctttggactcaaagccctctatgcccacttcagaaggtggcactgagctggag
ttacaaattcctgaactacctcttgacagcaatgaattttgggtccatgagggttgtatt
ctctgggccaatgggatctacctggtctgtggcaggctctatgggctgcaggaagctgtg
gagattgcaagagagatgaaatgttcccattgccaggaaccaggagccaccttaggctgc
tacaacaaaggctgctccttccgataccattacccatgtgccatcgatgcagattgttta
ctaaacgaagagaatttctcagtgaggtgccccaagcacaagcccctccttccttgctct
cttccctccttgcagaacaagatggtgaaaggcagcctcagcacagagcagtcggagcgg
gggtga

DBGET integrated database retrieval system