KEGG   Gallus gallus (chicken): 418044
Entry
418044            CDS       T01006                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04310  Wnt signaling pathway
gga04370  VEGF signaling pathway
gga04510  Focal adhesion
gga04520  Adherens junction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    418044 (RAC2)
   04310 Wnt signaling pathway
    418044 (RAC2)
   04370 VEGF signaling pathway
    418044 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    418044 (RAC2)
   04520 Adherens junction
    418044 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    418044 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:gga04031]
    418044 (RAC2)
GTP-binding proteins [BR:gga04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    418044 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 418044
NCBI-ProteinID: NP_001188381
CGNC: 9462
Ensembl: ENSGALG00000012456
UniProt: Q5F337
Position
1
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLSPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRTKKRACSLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaagccatcaagtgtgtcgtggtgggagatggagctgtgggaaaaacctgtctcctt
atcagctataccactaatgccttcccaggagaatacatccccactgtgtttgataactat
tctgccaacgtgatggttgacagcaagcctgtaaatctggggctttgggatactgctgga
caagaggattacgacaggctgaggccactctcttacccacagacggatgtcttcctgatc
tgcttctcccttgtcagcccagcatcttatgaaaacgtccgtgctaagtggttccccgag
gtgcggcaccattgccccagcactcccatcatccttgtgggcacaaagctggatcttcgt
gatgacaaagacaccattgagaagctgaaggagaagaagctttctcctattacatatcct
cagggtcttgccttggccaaggaaattgactctgtgaagtacctcgaatgctcggcgttg
acgcagcgtggcctgaagacggtgtttgatgaggccatccgagcagtcctctgcccacag
cccacccgaacgaagaaacgagcatgcagcctcctctag

DBGET integrated database retrieval system