KEGG   Gallus gallus (chicken): 418060
Entry
418060            CDS       T01006                                 

Gene name
ISX
Definition
(RefSeq) intestine-specific homeobox isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 418060
NCBI-ProteinID: XP_025011296
CGNC: 9534
Ensembl: ENSGALG00000012557
Position
1
AA seq 305 aa
MMDPCECASQRKPSLSFSIEEILKKPSASTTSNETRNRNKYAETSPALKAESLWAFDFSS
RSQLENDFPSDKMLLPAMCATRMTRAKKVQAAHCRRATDSPASFLGEDIGREHLEGKRKH
EEEEDQLCDFPVDHPLHVERKGKRRIRTTFTAEQLQELEKIFQVTHYPDVHIRNQLAAKI
NLPEARVQIWFQNQRAKWRKHEKFGNFGGLQHLTEVDFIPAPKSDITAPSLIPRKLAATI
PSIGYYSPLQGQLTTTWLPSTLSYIPHHLELLPFPKPCLLFNILPAYSAPRSHKLEQSSI
CASST
NT seq 918 nt   +upstreamnt  +downstreamnt
atgatggatccctgtgaatgtgccagccagaggaagcccagcctgtccttttccattgag
gagatcttaaagaagccttctgccagtaccaccagcaatgaaaccagaaacaggaataaa
tacgctgagacatctccagctttaaaagcagaatcactgtgggcctttgatttcagcagc
agaagtcaattagagaatgacttcccttcggataaaatgcttctccctgccatgtgtgct
acccgcatgaccagagcaaagaaagtgcaggcagctcactgcaggagagctactgacagc
ccagcttccttcctgggtgaggacataggacgtgaacacctggaaggcaaaagaaaacat
gaggaagaggaagaccaactgtgtgatttcccagtggaccatccacttcatgttgagagg
aaagggaaacggagaatccggacaacgttcacagctgagcagcttcaggaactggagaag
attttccaagtgactcactacccagatgtccatattcgcaatcagttggcagcaaagatt
aacctaccggaagccagagttcagatctggttccagaaccagagagccaagtggaggaaa
catgaaaaatttggcaactttggtggccttcagcatctgacagaagttgatttcattcct
gctcccaagtcagatatcacagctcctagcttgattccaaggaagcttgcagccaccatc
ccttccataggatactactcaccactgcaagggcagctgacaactacttggctgcccagc
acactctcctacatcccccaccacttggagctgctgcccttcccaaaaccatgcttgctc
ttcaacatcctccctgcctacagtgcaccacgctcccacaagttggaacagagcagtatc
tgtgccagctctacatag

DBGET integrated database retrieval system