KEGG   Gallus gallus (chicken): 418195
Entry
418195            CDS       T01006                                 

Gene name
SOX5
Definition
(RefSeq) transcription factor SOX-5
  KO
K09269  transcription factor SOX5/6/13 (SOX group D)
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418195 (SOX5)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    418195 (SOX5)
SSDB
Motif
Pfam: HMG_box HMG_box_2 MATalpha_HMGbox MPS2
Other DBs
NCBI-GeneID: 418195
NCBI-ProteinID: NP_001004385
CGNC: 9966
Ensembl: ENSGALG00000032768
UniProt: Q6A2A8
Position
1
AA seq 737 aa
MLTDPDLPQEFERMSSKRPASPYGEADGEVAMVTSRQKVGEEESDGLPAFHLPLHEVDGN
KAMSSFAPHNSSTSPLKAEEGGRQSGESLSSTALGTPERRKGSLADVVDTLKQRKMEELI
KNEPEETPSIEKLLSKDWKDKLLAMGSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQ
LLAAHDEQKKLAASQIEKQRQQMELAKQQQEQIARQQQQLLQQQHKINLLQQQIQVQGQL
PPLMIPVFPPDQRTLAAAAQQGFLLPPGFSYKAGCSDPYPVQLIPTTMAAAAAATPGLGP
LQLQQLYAAQLAAMQVSPGGKIPGISQGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPL
NLSAKPKTSDGKSPTSPTSPHMPTLRINSGTSSLKSSVPATLASPSARANTIDILSSITS
SGYLNDHDAVTKAIQEARQMKEQLRREQQVLDGKVAVVNSLGLNNCRTEKDKTTLETLTQ
QLAVKQSEDGKFSHAMMDFNMSGDSDGSAGVSESRIYRESRGRGSNEPHIKRPMNAFMVW
AKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYK
PRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQIPIATAGVVYPGAIAMAGM
PSPHLPSEHSSVSSSPEPGMPVIQSTYGIKGEEPHIKEEMQTDDVNGEIYDEYDEEEDDP
DVDYGSDSENHIAGQAN
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgctcactgaccctgatttacctcaggagtttgaaaggatgtcttccaagcgaccagct
tctccgtatggggaagcagatggagaggtagccatggtgacaagcagacagaaagtggga
gaagaggagagtgacgggctcccagcctttcaccttcccttgcatgaagttgatggcaat
aaagcgatgtcttcatttgccccgcacaactcatctacctcacccttgaaggcagaagaa
ggtgggcgtcagagtggagaatcattgtccagcacagccctgggaacccctgaaaggcgc
aaagggagcctagcggatgttgtagacacccttaagcaaagaaaaatggaagagctcatc
aaaaatgaaccagaagaaactcccagtattgaaaagctactatcaaaggactggaaagac
aagcttcttgccatgggatcagggaactttggagaaataaaagggactccagaaagcctc
gctgagaaagaaaggcagctcatgggtatgatcaatcagctgaccagtttgcgagaacag
ctgctagcagctcacgatgaacagaagaaactggctgcctcacagatcgagaagcaacgc
cagcaaatggagctggctaagcagcaacaggaacagattgcaagacaacagcagcagctc
ctgcagcagcaacacaaaattaaccttcttcagcaacagatccaggtccagggtcagctg
cctccattaatgattcccgtattccctccagaccaacgaaccctagcagcagctgctcag
caaggattccttcttcctcctggtttcagctacaaagcgggatgcagtgacccctaccct
gttcagctgatcccgactaccatggcagctgctgccgcagcaacaccaggcctaggcccg
ctccaactgcagcagttgtatgctgcccaacttgctgcaatgcaagtatctccaggaggc
aagatacctggcatatcccagggtaaccttggtgctgccgtatcgcctaccagcatccac
acagacaagagcacaaacagccctcctcccaaaagcaaggatgaagtggcccagcctctg
aacctttcagccaaacccaagacatctgatggcaagtctcccacgtcacccacctctcct
catatgccaactctgagaataaatagtgggaccagttcactaaaatcctctgtgccagca
acattagctagtccttcggccagagctaacacaatagatatcctttcttctatcacgtcg
tcaggttatttaaatgaccatgatgctgttaccaaggcaatccaggaggctcggcagatg
aaggagcaacttcggagggaacaacaggtgctggacgggaaggtggctgttgtgaatagt
ctgggtctcaataactgcaggacagaaaaggacaaaacgacactggagaccctgactcag
caactggcagtaaaacagagtgaagacgggaagtttagccacgcaatgatggatttcaac
atgagtggagattctgatggaagtgcaggagtttcagaatcaagaatttatcgggaatcc
agagggcgtggcagtaatgagcctcatatcaagcgcccaatgaatgcattcatggtgtgg
gctaaagatgaacggaggaagatccttcaagccttccctgacatgcacaactccaatatc
agcaagatactaggatctcgctggaaagctatgacaaacctagagaagcagccatactac
gaggaacaggcccgactcagcaaacagcacctggagaagtacccagactacaaatacaag
ccaaggccgaagcgtacctgccttgtagatggcaaaaaattacgcattggcgaatacaag
gctatcatgcgcaacagacgtcaggagatgaggcagtattttaatgttgggcaacaagca
cagattcccattgccaccgcaggtgttgtttacccaggagccatcgccatggcaggaatg
ccttccccacatctgccctcagagcactcaagtgtgtccagcagccccgagcccgggatg
cccgtcatccagagcacttacggcatcaaaggcgaggagccccatatcaaggaagagatg
cagaccgatgacgtcaatggagaaatctacgatgaatatgatgaggaagaggatgacccc
gatgtggactatggcagtgacagtgaaaatcacattgcggggcaagccaactga

DBGET integrated database retrieval system