KEGG   Gallus gallus (chicken): 418214
Entry
418214            CDS       T01006                                 

Gene name
FGFR1OP2
Definition
(RefSeq) FGFR1 oncogene partner 2 homolog
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: SIKE Tho2 CCD48 DUF3829
Other DBs
NCBI-GeneID: 418214
NCBI-ProteinID: NP_001007856
CGNC: 10511
Ensembl: ENSGALG00000014084
UniProt: Q5ZKJ4
Position
1
AA seq 217 aa
MKMSCTIEKALADAKALVERLREHDNAAEALIEQTTALNKRVEAMKQYQEEIQELNEVAR
HRPRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKD
DPSIIMKLKEQHSKELQVHVDQITEMAAVMRKAIEIDDKHGCKEQERIIQLEQENKGLRE
ILQITRESFLNLKKEDASESTSLSGLVTSSDLSLRKS
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaaaatgagttgcacaattgagaaagccttagcagatgctaaagcgctggtggaacgg
ctgcgggaacatgacaacgctgcagaagctcttattgaacagactacagctcttaataaa
cgggttgaagcaatgaagcagtaccaagaggaaattcaggagctcaatgaagtagcaaga
catcgtcctcgctctacattggtgatgggtatccaacaagaaaacagacagatcagggaa
ttacaacaggagaataaagaactgcgcacatctcttgaagaacatcagtctgctttggaa
ctcataatgagcaagtacagagaacagatgtttaggttgcttatggcaagcaaaaaggat
gatccaagtataataatgaaattaaaagagcaacattccaaggaactacaagtgcacgtg
gaccaaattacagaaatggcagcagtaatgaggaaagccattgaaattgatgacaagcat
ggctgtaaagagcaggaacgtatcattcagcttgaacaagaaaacaaaggcttgagagaa
attcttcagataaccagagaatcattcctgaaccttaagaaagaagatgcgtcagagagt
acatcactttcaggattagtaacaagcagtgatttgagcctgaggaagagctaa

DBGET integrated database retrieval system