KEGG   Gallus gallus (chicken): 418239Help
Entry
418239            CDS       T01006                                 

Gene name
ARHGAP8
Definition
(RefSeq) rho GTPase-activating protein 8
  KO
K20633  Rho GTPase-activating protein 8
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    418239 (ARHGAP8)
Membrane trafficking [BR:gga04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    418239 (ARHGAP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP CRAL_TRIO_2 CRAL_TRIO
Motif
Other DBs
NCBI-GeneID: 418239
NCBI-ProteinID: NP_001191318
CGNC: 50713
Ensembl: ENSGALG00000019261
UniProt: E1C874
Position
1
AA seq 424 aa AA seqDB search
MSEIDYEKLAEIELQKDEAEDTQSGQEKTFTSPPLEDPELDINHPYYDVARHGIIQLAGD
DNSGRKVITFSCCRMPPSYQLNHTRLLEYLKYTLDQYVENDYTVVYFHYGLKSLNKPSLK
WLQTAYKEFDRKYKKNLKALYVVHPTNFIKILWNIFKPLISHKFGKKVTYLNYLSDLREH
LKYDQLNIPQEVVRHDENLRGKHKGKLPPVVKVPPPRPPLPTQQFGVSLQYIKDKNRGEL
IPPVMKETVSYLKRKGLQVEGLFRRSASIQTIKDVQKLYNQGKPVNFDDYHDIHIPAVIL
KTFLRELPQPLLTFECYDPIVGITSVESCLRVTRCKQIIQGLPEHNYIVLKYLICFLHMV
SQESIYNRMTASSLACVFGLNLIWPSKGTASLSALVPLNLFTELLIDFYMNIFSSRTVPG
EILP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagattgactatgagaagttagctgaaatagaactacagaaagatgaagcagaa
gatacacagtcaggacaagagaaaacatttacgtctccaccacttgaggatcctgagcta
gatatcaatcatccctactatgatgttgcaagacatggcatcatccagttagcaggtgat
gacaattctggaaggaaggtgattaccttcagttgctgccgtatgcccccctcctaccag
ctcaatcataccagattgctggagtacttgaagtatactctggaccagtatgtagagaat
gattatactgttgtctactttcactacggcctgaagagtctgaataaaccatcactgaaa
tggttacaaactgcctacaaagaatttgacaggaagtataagaaaaaccttaaagcactc
tatgttgtacatccaaccaacttcataaaaattctgtggaatatttttaaacctcttata
agccataagtttgggaaaaaagtcacctacttgaactatttaagcgacctgagagaacat
ctcaaatatgaccagcttaatattcctcaagaagtcgtccgacatgatgaaaatcttcgg
gggaaacacaagggaaaactgccacctgtggttaaggttcctccaccaagaccacctcta
cctactcagcaatttggagtcagcctgcaatatatcaaggacaaaaatagaggtgaatta
attcccccagtaatgaaggaaactgtgtcctacctaaaaagaaaaggactacaagtagag
ggcctcttcagaaggtcagccagcatccagactatcaaagatgttcagaagctctacaat
cagggcaagcctgtaaattttgatgactatcatgatatccatattcctgctgttatccta
aagactttccttagggaacttcctcagccattgctaacctttgagtgttatgatcctatt
gttggaattaccagtgtggagagctgtttacgagtaaccagatgtaaacaaatcattcaa
ggacttcctgaacacaattacattgttctgaaatatctgatatgctttctccatatggtt
tcacaggagagcatatataacagaatgacggcatccagcctggcctgtgtctttggcttg
aatttgatctggccatctaaaggaacagcctctctgagtgctctggtgcctctgaatctc
ttcactgaactactaatagatttctacatgaatatattcagctcccgaacagtgcctggt
gagatcttaccttaa

DBGET integrated database retrieval system