KEGG   Gallus gallus (chicken): 418259
Entry
418259            CDS       T01006                                 
Symbol
FOXJ2
Name
(RefSeq) forkhead box protein J2 isoform X1
  KO
K09403  forkhead box protein J2/3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418259 (FOXJ2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    418259 (FOXJ2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 418259
NCBI-ProteinID: XP_004938150
CGNC: 10669
Ensembl: ENSGALG00000014329
Position
1:complement(75474688..75512376)
AA seq 554 aa
MMQPIANTAASNIMASDLESSLTSIDWLPQLTLRATIEKLGGSSQAGPPGAARKCPPGSP
TDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAG
IGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDIPQDSPEQ
EASKSPRGAVPVSTEASLPPEATPQLSLQSTAPIANYSQSAGPVDVASTVAGGQGREGAD
VPPPLYSANHDFKFSYSEINFQDLSWSFRNLYKSMLEKSSSSQHGFSSLLGDMQPSNHNY
YMYQQQQQGPSAVGAAPPLHTPTPEGCPSQGGKQQGGESYGPPPVMSMHPPPMQHGGYHQ
HQHHPHSHPQQQPHQHQQQQQSQASINNAGFAFPPDWCSSIDSLKESFKMVNRLNWSSIE
HSQFSELMESLRQAERKNWTLDQHHIANLCDSLNHFLTQTGQLPHLVGPQQPPRISDSCA
LNSGKQEQSINQVNSYGQPQPPHLFSGPSPMYQISTQDSPGYNRPAHHLVPRPSGPPPGT
NEEIPDDFDWDLIT
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgatgcagccaattgcaaatacagctgcttccaatatcatggcctctgacctggaaagc
agcctcacttccatagactggctcccacagcttactttaagagctactattgaaaaatta
gggggttcctcacaagcaggacctccaggggctgcccgaaagtgtcctccaggctcaccg
acagatcccaatgctactctcagtaaggatgaggctgcagtgcatcaagatggcaagcca
cgttacagttatgccactctgatcacatatgcaatcaattcatcccctgccaagaagatg
acacttagtgagatttaccgttggatctgtgacaactttccctactacaaaaatgctggt
attggttggaagaactcaattcgtcataacctctctctgaataagtgttttcgtaaagtg
cctagaccaagggatgatccagggaagggctcttattggacaatagatacgtgtccagat
atatctcgcaagaggcggcatcctcctgatgatgacataccacaagactccccggagcaa
gaggcaagtaagagcccccgaggggctgttccagtcagcacagaagcatctttgccacct
gaggctacccctcagctgtcacttcagagcactgcccccattgccaactatagtcagtct
gcagggcctgtggacgttgcctctactgtagcagggggacagggccgtgaaggggctgat
gtaccccccccactgtacagtgccaaccacgacttcaagttctcctactctgagatcaac
tttcaggatcttagctggtccttccgaaatctctacaaatccatgctggagaagtcgtct
tcctctcagcacggtttctcttctctccttggtgacatgcagccctccaaccataactac
tacatgtaccagcaacaacagcagggcccctcagcagtgggtgctgctccaccactccac
actccaactccagagggttgcccatcccaagggggaaagcagcagggtggtgaaagttat
ggccctccaccagtgatgtccatgcaccctcccccaatgcagcatggaggctaccaccag
catcaacatcacccacactcccacccacagcagcagccacatcagcatcagcagcagcag
cagtcacaggcttcaatcaacaatgctggctttgcatttcctcctgattggtgctccagc
attgattccctgaaggagagcttcaagatggtaaaccggctgaactggtctagcattgag
cactcccaattttcagagttaatggagagtctgcgccaggccgagcggaagaactggaca
ctggatcaacaccatattgccaatctctgtgactctcttaatcacttccttacccagact
ggtcagctccctcatctggttggcccacagcagccccctcgaatctctgattcttgtgcc
ctaaacagtggcaaacaggagcaatccataaatcaagtgaactcttatggtcagccccag
cctccccatctcttctccggtccatctccgatgtaccagatttctacccaagactctcca
ggatataatcgcccagctcatcatctggtccctcggccttcagggcctcctccaggcacc
aatgaggaaatccctgatgatttcgactgggacttgatcacctag

DBGET integrated database retrieval system