KEGG   Gallus gallus (chicken): 418295
Entry
418295            CDS       T01006                                 

Gene name
C1R
Definition
(RefSeq) complement C1r subcomponent
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    418295 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    418295 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    418295 (C1R)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     418295 (C1R)
Peptidases and inhibitors [BR:gga01002]
 Serine peptidases
  Family S1: chymotrypsin family
   418295 (C1R)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Phagocytosis
   Opsonins
    418295 (C1R)
SSDB
Motif
Pfam: CUB Trypsin Sushi FXa_inhibition cEGF CUB_2 EGF_CA hEGF EGF
Other DBs
NCBI-GeneID: 418295
NCBI-ProteinID: XP_416518
CGNC: 50728
Ensembl: ENSGALG00000014659
UniProt: F1NAB7
Position
1
AA seq 712 aa
MEMHTPFLLWATLFTGVISSGPVPRKLFGEIRSPNYPKPYPNNNISSWDIIVPKGYVVKL
TFRYFDLEPSETCFYDYVKIRADKKSLGRYCGQLGSTTGNHPGRKEFVSKGNRMHLSFHS
DFSNEDNGVVVPYRGFLAYYKAVDLDECDPDNAAEDDEGLRCQHICHNYVGGYFCSCRPG
YQLQSDYRSCKVECSSELFTEASGYLSSPEYPHPYPEDLQCNYSIRLEKGLSVILKFLEP
FEIDDHQQVHCPYDQLQIQARGREIGEFCGKKSPGSIETKSNEVDILFFTDESGYSRGWK
IHYTSERIRCPQPVPRDQFTIIRDLQPVYRYQDYFIVSCQTGYNLVEGNRTLLSFTAVCQ
ADGTWHQPMPRCEIVNCGSPAKLTNGIFSYVNKPANNTYQSVITYQCNEPYYHIVTRGGG
DRYTCSSEGTWVDRDGQKRIPACLPVCGKPDNPVIGVQRIVGGKKAREGNFPWQALTEIH
GRGGGALLSDRWILTAAHTIFPKGSARNNVSLDELAKDASIFLGHSDVEQIIRMGNHPVH
RIFIHPDYNPNDEHNYNGDIALLELKYPVTLGPTVLPICLPDTSNTTFYMDGYMGYVSGF
GVEKNFLSNNLKYVQLPAVSREKCQSWLDSKKRENPMVFSENMFCAGFLREKRDTCQGDS
GSAFTVLDLESGRWVATGIVSWGIGCAQGYGFYTKILGYLDWIKGIIKEDTL
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggagatgcacactccttttctcctgtgggccaccctctttactggagtgatcagttcc
ggtccagtcccgagaaagttatttggggagatcagatccccaaattatcccaagccatac
cccaacaataacatcagcagttgggatatcattgttcccaaaggctatgtggtgaagctg
accttcagatattttgacctggagccatcagagacctgtttctatgactatgttaagatc
agagcagacaagaagagcttggggcgatactgtgggcagcttgggtcaaccacaggcaat
cacccaggaagaaaggagtttgtatctaagggaaacaggatgcatctttcatttcactct
gatttctccaatgaagacaatggcgtggtcgttccctacaggggcttcctggcctattat
aaagctgtggatcttgatgaatgtgatcctgacaatgctgctgaggatgatgaggggctt
cggtgccagcatatctgtcacaactatgtgggtggctacttctgttcttgccgacctggc
tatcagctccaaagtgactaccgctcctgcaaagtggagtgcagcagtgagttgttcaca
gaggcatctgggtacctgagcagcccagagtacccccacccctatcctgaagacctccag
tgtaactacagcatccgtctggaaaaaggcctgtctgtcatcctgaagttcttggaacct
tttgagattgatgaccaccagcaagtccattgtccctatgatcagctccagatccaagca
cgagggagagagatcggtgaattctgtggcaagaagtcacctggcagcatagaaaccaaa
agcaatgaggtggacatactcttcttcactgatgaatcagggtacagtcgcggttggaag
atccactacacctcggagagaatacggtgcccacagcctgtcccacgggatcagtttacc
atcatcagagacctgcaacctgtgtatcgatatcaagactatttcattgtcagctgccag
actggctataacttggtggagggcaaccggacgctgctgtccttcactgctgtctgccag
gctgatgggacatggcatcaacccatgccccgctgtgaaattgtgaactgtggcagccct
gcaaaactgaccaatggaatattcagttatgttaacaaacctgcgaacaacacctaccag
tcagtgatcacataccagtgtaatgaaccgtactatcacattgtcaccagaggaggaggt
gatagatacacctgctcttctgagggaacctgggtggatcgagatggccagaagaggatt
cctgcctgcttgccagtgtgtgggaagccggacaaccctgttattggagtccagaggatt
gtgggtggtaaaaaagcccgcgagggcaatttcccttggcaggctctgactgaaatccat
ggacgtggaggtggagcactcctgagtgatcgctggatcttgacagctgcccacaccatc
ttccccaaagggtcagcaaggaacaatgtaagcctcgatgagctagcaaaggatgctagc
attttccttggccacagtgatgtagaacagatcatcaggatgggtaaccaccccgtacat
aggatctttatccatcctgattacaatcctaacgatgagcataactacaacggagacata
gcactgctggagctgaaatacccagtaaccctaggccctacggtactgcccatctgtctc
ccagatactagcaacaccacattctacatggatgggtacatgggctacgtgagtggcttt
ggtgtggaaaaaaactttctttcaaataatttgaaatatgtgcaactaccagcagtttct
cgcgagaaatgccagagttggctggatagtaagaaaagagagaatcctatggttttctct
gagaacatgttctgcgctggcttcctcagggagaaacgagatacatgccagggggatagt
gggagtgccttcacagtgttagacttggaaagtggtcggtgggtggcgactggtattgtt
tcttggggtatcggctgtgcccaaggttatggcttctacaccaagatcctcggctatttg
gactggatcaaagggataataaaggaggatacgctctaa

DBGET integrated database retrieval system