KEGG   Gallus gallus (chicken): 418300
Entry
418300            CDS       T01006                                 

Gene name
ZYX
Definition
(RefSeq) zyxin
  KO
K06273  zyxin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    418300 (ZYX)
SSDB
Motif
Pfam: LIM zf_C2H2_13
Other DBs
NCBI-GeneID: 418300
NCBI-ProteinID: NP_001004386
CGNC: 10889
Ensembl: ENSGALG00000014688
UniProt: Q04584
Position
1
AA seq 542 aa
MASPGTPGTRMTTTVSINISTPSFYNPQKKFAPVVAPKPKVNPFKTGGTSESSQPQPPGT
GAQRAQIGRVGEIPVSVTAEELPLPPPPPPGEELSFSSNCAFPPPPPPFEEPFPPAPDEA
FPSPPPPPPPMFDEGPALQIPPGSTGSVEKPLAPKAHVEISSAPRDPTPPFPSKFTPKPS
GTLSSKPPGLDSTPAPAPWAAPQQRKEPLASVPPPPSLPSQPTAKFTPPPVASSPGSKPG
ATVPMAPSNSTRYPTSLQTQFTAPSPSGPLSRPQPPNFTYAQQWERPQVQEKPVPTEKSA
AVKDMRRPTADPPKGNSPLTMKEVEELELLTQKLMKDMDHPPPVEAATSELCGFCRKPLS
RTQPAVRALDCLFHVECFTCFKCEKQLQGQQFYNVDEKPFCEDCYAGTLEKCSVCKQTIT
DRMLKATGNSYHPQCFTCVMCHTPLEGASFIVDQANQPHCVDDYHRKYAPRCSVCSEPIM
PEPGKDETVRVVALEKNFHMKCYKCEDCGRPLSIEADENGCFPLDGHVLCMKCHTVRAKT
AC
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcttctccaggtaccccagggacccgtatgacaaccacagtcagtatcaacatttcc
acaccgtccttttacaacccacagaagaaatttgcacccgtggttgcccctaaacccaag
gtgaatcccttcaagactgggggtacatcggagtcatcgcagccacagcctcctggaact
ggtgcccagcgtgcccagatagggagagtgggagagatccccgtatctgtgacagcagaa
gagctgccgctgccacctcctcccccacctggagaggagctaagtttctcctcaaactgt
gcttttcctccacccccaccaccctttgaagagcctttcccaccagccccagatgaagct
tttccttctcctcctccacctcctccaccaatgtttgatgaaggacctgccctacagata
cctccaggatccacgggttctgtggagaaaccgttggccccaaaagctcacgtggaaatc
tcatctgcacccagagatcctactcctccttttccttccaagttcactccaaagccaagt
ggtaccttatcttccaagccccctggattggattcaactcctgccccagctccatgggca
gctccacagcagcgcaaggagcccctagcctcagtccctccacccccctctctcccttct
cagcctactgctaaattcacaccaccccctgttgccagctctcctggatccaaaccaggt
gccactgttcccatggctccttcaaactctacaagatatcctacatcccttcagactcag
ttcactgccccttcaccctccggtcccttgtctcgacctcagcctcccaatttcacctat
gctcagcagtgggaaagacctcaggtgcaggagaaacctgttcccactgaaaaatctgct
gctgtaaaagacatgcgtagacccactgcagatccgcctaagggaaactctcctctgacc
atgaaggaggtagaagagctggagctgttgacccagaaactaatgaaggatatggatcat
ccacctccagtagaagctgctacttctgagctctgtggcttctgtcggaagcccctgtca
cggacccagccagctgtgagagctctggactgccttttccacgtggagtgcttcacctgc
ttcaagtgtgagaagcagctgcaggggcagcagttctacaatgtggatgaaaagcccttc
tgcgaggactgctatgctggaaccctggaaaagtgcagtgtctgcaaacagactatcaca
gacaggatgctgaaggccaccggtaactcataccatcctcagtgcttcacctgtgtgatg
tgccatactcctctggagggggcctccttcatagtggaccaggccaaccagcctcactgt
gtggatgactaccacaggaagtatgctccacgctgctcagtatgtagtgaacctatcatg
ccagagcctgggaaagatgagacagtgcgtgtggtggcactggagaaaaacttccacatg
aaatgttacaagtgtgaggactgtgggaggcccttatctattgaggctgatgaaaatggc
tgctttccactggatgggcacgtactatgtatgaaatgtcacactgttcgtgctaaaaca
gcgtgctga

DBGET integrated database retrieval system