KEGG   Gallus gallus (chicken): 418308
Entry
418308            CDS       T01006                                 

Gene name
EPHB6
Definition
(RefSeq) ephrin type-B receptor 5 precursor
  KO
K05114  Eph receptor B6 [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    418308 (EPHB6)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     418308 (EPHB6)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   418308 (EPHB6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_2 SAM_1 EphA2_TM Ephrin_rec_like Pur_ac_phosph_N cEGF Kdo Pkinase_fungal Caskin1-CID
Other DBs
NCBI-GeneID: 418308
NCBI-ProteinID: NP_001004387
CGNC: 50733
Ensembl: ENSGALG00000014749
UniProt: Q07497
Position
1
AA seq 1002 aa
MDSNADISARRVSGMDWLWLVCFFHLVTSLEEILLDTTGETSEIGWTSHPPDGWEEVSVR
DDKERQIRTFQVCNMDEPGQNNWLRTHFIERRGAHRVHVRLHFSVRDCASMRTVASTCKE
TFTLYYHQSDVDIASQELPEWHEGPWTKVDTIAADESFSQVDRTGKVVRMNVKVRSFGPL
TKHGFYLAFQDSGACMSLVAVQVFFYKCPAVVKGFASFPETFAGGERTSLVESLGTCVAN
AEEASTTGSSGVRLHCNGEGEWMVATGRCSCKAGYQSVDNEQACQACPIGSFKASVGDDP
CLLCPAHSHAPLPLPGSIECVCQSHYYRSASDNSDAPCTGIPSAPRDLSYEIVGSNVLLT
WRLPKDLGGRKDVFFNVICKECPTRSAGTCVRCGDNVQFEPRQVGLTESRVQVSNLLARV
QYTFEIQAVNLVTELSSEAPQYATINVSTSQSVPSAIPMMHQVSRATSSITLSWPQPDQP
NGVILDYQLRYFDKAEDEDNSFTLTSETNMATILNLSPGKIYVFQVRARTAVGYGPYSGK
MYFQTLMAGEHSEMAQDRLPLIVGSALGGLAFLVIAAIAILAIIFKSKRRETPYTDRLQQ
YISTRGLGVKYYIDPSTYEDPNEAIREFAKEIDVSFIKIEEVIGSGEFGEVCFGRLKHPG
KREYTVAIKTLKSGYTDEQRREFLSEASIMGQFEHPNVIHLEGVVTKSRPVMIVTEFMEN
GSLDSFLRQKEGQFSVLQLVGMLRGIAAGMRYLSDMNYVHRDLAARNILVNSNLVCKVSD
FGLSRFLEDDASNPTYTGALGCKIPIRWTAPEAVQYRKFTSSSDVWSYGIVMWEVMSYGE
RPYWDMSNQDVINAIDQDYRLPPPPDCPTVLHLLMLDCWQKDRVQRPKFEQIVSALDKMI
RKPSALKATGTGSSRPSQPLLSNSPPDFPSLSNAHEWLDAIKMGRYKENFDQAGLITFDV
ISRMTLEDLQRIGITLVGHQKKILNSIQLMKVHLNQLEPVEV
NT seq 3009 nt   +upstreamnt  +downstreamnt
atggattctaatgctgacatcagtgcaagaagagtgtcaggaatggattggctctggctg
gtttgcttctttcatctagtcacttcactagaagaaatacttctggatacaactggagaa
acctcagagattggctggacctctcaccctcctgatgggtgggaagaagtaagtgtccgg
gatgataaggagcgccagatccgaacctttcaagtttgtaacatggatgaaccaggtcag
aataactggttgcgtactcacttcatagagcgacgtggagcccaccgagtccatgtccgc
cttcatttctcagtgagggactgtgccagcatgcgtactgtggcctctacttgcaaagag
actttcacactctactaccaccagtcagatgtcgacatagcctctcaggaactgccagag
tggcatgaaggcccctggaccaaggtggatactattgcagctgatgaaagcttttcccag
gtggacagaactgggaaggtggtaaggatgaatgttaaagtacgcagctttgggccactc
acaaagcatggcttctacctggccttccaggactcaggagcctgtatgtccctggtggca
gtccaagtctttttctacaagtgtccagctgtggtgaaaggatttgcctccttccctgaa
acttttgctggaggagagaggacctcactggtggagtcactagggacgtgtgtagcaaat
gctgaagaggcaagcacaactgggtcatcaggtgttcggttgcactgcaatggagaagga
gagtggatggtggccactggacgatgctcttgcaaggctggttaccaatctgttgacaat
gagcaagcttgtcaagcttgtcccattggttcctttaaagcatctgtgggagatgaccct
tgccttctctgccctgcccacagccatgctccactgccactgccaggttccattgaatgt
gtgtgtcagagtcactactaccgatctgcttctgacaattctgatgctccctgcactggc
atcccctctgctccccgtgacctcagttatgaaattgttggctccaacgtgctcctgacc
tggcgcctccccaaggacttgggtggccgcaaggatgtcttcttcaatgtcatctgcaag
gaatgcccaacaaggtcagcagggacatgtgtgcgctgtggggacaatgtacagtttgaa
ccacgccaagtgggcctgacagaaagtcgtgttcaagtctccaacctattggcccgtgtg
cagtacacttttgagatccaggctgtcaatttggtgactgagttgagttcagaagcaccc
cagtatgctaccatcaacgttagcaccagccagtcagtgccctccgcaatccctatgatg
catcaggtgagtcgtgctaccagtagcatcacactgtcttggcctcagccagaccagccc
aatggggttatcctggattaccagctacggtactttgacaaggcagaagatgaggataat
tcatttactttgactagtgaaactaacatggccactatattaaatctgagtccaggcaag
atctatgtcttccaagtacgagctagaacagcagtgggttatggcccatacagtggaaag
atgtatttccagactttaatggcaggagagcactcggagatggcacaggaccgactgcca
cttattgtgggctcagcacttggtggtctggcattcttggtaattgctgccattgccatt
cttgccatcatcttcaagagtaaaaggcgagagactccatacacagaccgcctgcagcag
tatatcagtacacgaggacttggagtgaagtattacattgatccttccacgtatgaagat
cccaatgaagctattcgagagtttgccaaagagatagatgtgtccttcatcaaaattgag
gaggtcattggatcaggagaatttggagaggtgtgctttgggcgcctaaaacacccaggg
aaacgtgaatacacagtagctattaaaaccctgaagtcaggttatactgatgaacagcgt
cgagagttcctgagcgaggccagcatcatggggcaatttgagcatcccaatgtcatccac
ctggagggcgtggtcaccaaaagccgaccagtcatgattgtcacagaattcatggagaat
ggatcactggattccttcctcaggcagaaggagggacagttcagtgtgttacagctggtg
ggaatgctacgagggattgcagcaggcatgcgctacctttcagacatgaactatgtgcat
cgtgatctcgcagcacgtaacatcttagtcaacagtaaccttgtatgcaaggtgtcagac
tttggtttgtctcgctttctggaagatgatgcttcaaatcccacttatactggagctctg
ggttgcaaaatccccatccgttggactgcccctgaagctgtccagtatcgcaagttcacc
tcctccagtgatgtctggagctatggcattgtcatgtgggaggtgatgtcctatggtgag
agaccttactgggacatgtccaaccaggatgtaattaatgccattgaccaggactatcgc
ctgccaccacccccagactgcccaactgttttgcatctgctgatgcttgactgctggcag
aaggatcgagtccagagaccaaaatttgaacaaatagtcagtgccctagataaaatgatc
cgcaagccatctgctctcaaagccactggcactgggagcagcagaccatctcagcctctc
ctgagcaactcccctccagattttccttcactcagcaatgcccacgagtggttggatgcc
atcaagatgggtcgttacaaggagaattttgaccaggctggtctgattacatttgatgtc
atatcacgcatgactctggaagatctccagcgtattggaatcaccctggttggtcaccag
aaaaagattctaaacagcatccagctcatgaaagttcatttgaaccagcttgaaccagtt
gaagtgtga

DBGET integrated database retrieval system