KEGG   Gallus gallus (chicken): 418313
Entry
418313            CDS       T01006                                 

Gene name
TBX15
Definition
(RefSeq) T-box transcription factor TBX15
  KO
K10182  T-box protein 15
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    418313 (TBX15)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Other transcription factors
   T-box
    418313 (TBX15)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 418313
NCBI-ProteinID: XP_416537
CGNC: 10960
UniProt: F1NA14
Position
1
AA seq 601 aa
MSERRRSAVALSSRAHAFSVEALIGTNKKRKLRDWEDKGLDLSMESLSPNGQLGDGEDPT
QCLDLNPDSEQSTGSDTEVLAERTSCSFGSHSDLTSGGSGPQPPPPSSMEEIQVELQCAD
LWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSK
WMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQ
PRVHVIRKDFSSDLSPTKPVPSGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKG
FRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPSA
SSHLLSPSCSPPAFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLGDSGY
NRLQSGTASASQPSESFMPQRTPSLISGMPTPSSLPSNSKMEAYSSQLGSFPSSQFQYVM
QAGNPASSSSSSHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPASPRLAASPEKLTTSQST
LLCSSPSSGAFGERQYLSTGMDHGMHMISPPSSNQQTANACDNRQYGAVQGSSSQMSVHM
V
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgagcgagaggcggaggtcggcggtggccctcagctcccgggcgcacgcattctcggtc
gaagccttgattgggacgaataaaaagaggaaactgcgggactgggaggacaaggggctg
gatttgtccatggaaagcctcagccccaatggccagctgggcgacggcgaggacccgacg
caatgcctggacctcaaccccgactcagaacagagcactgggtcagacacagaggtgttg
gcagaaagaacgtcttgctcttttggctcccattctgaccttacatctggtggatcgggt
cctcagcctcctccaccttcatccatggaagagatccaagtagaactgcagtgtgctgac
ctctggaaaagatttcatgacattgggacagagatgatcatcacgaaagcaggcaggaga
atgtttccagccatgagggtgaaaatcacaggtttggatccacaccagcagtattatatt
gctatggacattgtacctgtggataacaagagatacaggtatgtgtatcacagctccaaa
tggatggtggctggcaatgccgactctccagtgcccccaagggtttacatccacccggac
tcattggcttctggagacacttggatgaggcaggtggtcagttttgacaagctcaagctg
accaacaatgaacttgatgatcaaggacatataattttacattcaatgcataagtaccag
cctcgtgttcatgtcatccgcaaggatttcagcagtgatctttctccgacaaagccagtt
ccctcaggagatggggtgaaaaccttcaacttccctgagactgtcttcaccacagtgaca
gcctaccagaatcaacagatcaccagattaaaaattgacagaaacccttttgctaaaggc
ttcagagattctgggagaaacaggacggggctggaggccatcatggagacctacgccttc
tggaggccccctgtgcgcactctcacctttgaggatttcaccaccatgcagaagcagcaa
ggaggcagcacaggcacctctccaacaacctccagcacagggactccatcaccctctgct
tcctctcaccttctctctccatcctgctcccctccagccttccatctggcccccaacact
ttcaatgttggttgccgggagagtcagctttgcaacctcaacctgtctgactaccctcca
tgtgccagaagcaacatggctgccctgcagagctacccagggctgggcgacagtggctac
aaccggctgcagagtggcactgcttctgcctcacagccctccgaaagcttcatgcctcag
aggactccatctctgatctcaggaatgccaactccttcttctctgcccagcaacagcaag
atggaggcctacagcagccagctggggtcctttcccagctcccagtttcagtatgtcatg
caagcaggcaatcctgcatccagttcttcttcttcacacatgtttggtggcagccacatg
cagcagagctcctacaacgccttctccctgcacaatccctacaacctctatggatacaat
ttccctgcttccccaaggctggcagcaagcccagagaaactcaccacttcccaaagcact
ttactctgctcttccccttccagtggggcctttggagagaggcaatacctttccacaggg
atggatcatggtatgcacatgatcagccctccctccagcaaccagcagacagccaatgcc
tgtgacaacagacagtatggtgctgttcagggctcctcctcacagatgtctgtgcacatg
gtctaa

DBGET integrated database retrieval system