KEGG   Gallus gallus (chicken): 418361
Entry
418361            CDS       T01006                                 

Gene name
BOC
Definition
(RefSeq) brother of CDO isoform X3
  KO
K20020  brother of CDO
Organism
gga  Gallus gallus (chicken)
Pathway
gga04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    418361 (BOC)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig ISET-FN3_linker V-set C2-set_2 Pur_ac_phosph_N Ig_4 Ig_5 C1-set
Other DBs
NCBI-GeneID: 418361
NCBI-ProteinID: XP_015152030
CGNC: 11276
Ensembl: ENSGALG00000015152
UniProt: E1C5M1
Position
1
AA seq 1107 aa
MAMTRGKKRPMSAILCLLLAATSCFAKLSESLQVTVQPASTVQKPGGSVSLWCVVDPPRV
NLTWRLNGKELDGSDEMLGIHIEQGKLIITALNNHTVGRYQCIARVPEGVIASVPAVVTL
ANLKDFKFDGPHVIEVDEGNTAVIACDLPESHPKAQVRYSVKHEWLEASRDNYLIMPSGN
LQIVNASQEDEGTYKCAAYNPVTQEVKTSVSSERLRVRRSTAEAARIIYPPEAQTIIVTK
GQSLILECVASGIPPPRVTWAKDGSSVSAYNKTRFLLSNLLIDPTSEEDSGTYSCTADNG
VGEAGAAFIFYNVQVFEPPEVTMELSQQIIPWGQSAKFTCEVRGNPQPSVMWLRNAVPLS
ASHRLRLSRRALRVVSVGPEDDGIYQCMAENEVGSAQAMVQLRTAQPGATLNPGQDAQLD
SARPPTPPSRDSALKLPLDKGSPPKPVTTPLAAFSQCSANKELVSPAEAPIILSSPRTSK
TDSYDLVWRPRPDSRAPILYYVVKHRKVANASDSWAVRDVPASQHRLTLTRLDPGSLYEV
EMAAHNCAGEGQTAMVTFRTGKGRRPKPEIVASKEQQIQRDDPGTSTQSSNQSDNSRLSP
PEAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKQKKSGDWVLATSDIPPSRLS
VEIPDLEKGFSYKFRVRALNILGESEPSAASRPYVVSGHNNRVYERPVAGPYITFTDAIN
ETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSISHLQPETS
YDIKMQCFNEGGESEFSNVMICETKARKSLGLPGRLPPSTVAPQQHPPLSGGHSGLGTGA
MVARSSDLPYLIVGVVLGSIVLLIVAFIPFCLWRAWSKQKQTIDMGFPGAGLLVSSCQYT
MVPLRGISAPRANGHPYVNGQPYASGAHLNGICPSAGVDYVSTKPQDYSPDDMQQSHEET
NALLQARVLQNGNAHQDYQPTRLPSSRPEDSSFLYSLPDDSTHQLLQPQDDCPHLQERFV
GLHHPVMGNKVGGSSLDPRRDPLFHHGSPFCLGLVPVEEVERLDCCQSRGDLHPPAPVLT
SLSQDLPGHLNSSSPSLRPLETHSPIS
NT seq 3324 nt   +upstreamnt  +downstreamnt
atggcaatgacacgtggaaagaagagacccatgtccgccatcctttgcctcctcctcgca
gccacgagctgctttgccaaactgagtgaatctctgcaagtcactgtgcagcctgcctcc
accgttcagaagcctgggggctcggtcagcctgtggtgtgttgtggaccccccaagagtg
aacctcacctggagactgaatggaaaggagctggatggatcagacgagatgctggggatc
cacatcgagcaagggaaactcattatcacagctctcaacaaccacaccgtggggcgatac
cagtgcattgctcgtgtgcccgaaggagtcattgccagtgtccccgcagtggtcaccttg
gctaatctcaaggatttcaagtttgatggccctcacgtgattgaggtggatgaaggcaac
acggctgtcatcgcctgtgacctgcccgaaagccatcccaaggcccaggtccgctacagc
gtgaagcatgagtggctggaggcctcccgagacaattaccttatcatgccatccgggaac
cttcagattgtcaatgcaagccaagaagatgaggggacttataaatgtgctgcctacaat
cctgtgacacaggaggtgaaaacctcagtctctagtgagaggctccgcgtgagacgctcc
acagcggaggccgctcggataatctatccgcctgaagctcagaccatcattgtcaccaaa
ggccaaagcctcatcctggagtgtgtggccagtgggatccccccgccccgtgtcacctgg
gccaaagatggctccagtgtctcagcgtacaataagacacggttcctgctcagcaacctt
ctgattgaccctaccagtgaggaggactcaggcacctacagctgcacggctgacaacgga
gttggtgaggctggagcagcattcatcttctacaacgtgcaggtgtttgagcccccagag
gtcaccatggagctgtcccagcagatcattccctggggccagagcgccaagttcacctgc
gaggtgcgaggaaacccccagccctcagtcatgtggctgcgcaatgctgtgcccctctct
gccagccaccggctccggctgtcccgccgggcgctgcgagtggtcagtgtggggcctgaa
gatgatggcatttaccagtgcatggcagagaatgaggttggaagtgcacaagccatggtg
cagctgaggacggcccagccaggagctaccctcaaccctgggcaagatgctcagctggat
tcagctcggcctccaacaccgccttccagggacagtgccttaaagctgcctctggataaa
ggtagtccaccaaagcctgtgaccactccactggcagcgttttcacagtgctcagccaac
aaggagctggtgtctccagctgaggcccccatcatcctcagttctccccggacatccaaa
acagacagctacgacctagtgtggagaccccggcctgacagcagggccccaatcctctac
tatgtggtgaagcatcgcaaggtggccaacgcctcagacagctgggcagtgagagatgtg
ccagcctcgcagcaccgcctgacactcaccaggttggatcctggaagcctctacgaggtg
gagatggccgctcacaactgcgctggcgagggacagacggccatggtgaccttccggact
ggtaaaggccggcgcccaaaaccagagattgttgccagcaaagaacagcaaatccagagg
gatgacccaggcacgagcactcagagcagcaaccagtctgacaacagccggctgtcccct
ccagaggcaccagatcgtccaaccatctccatggcatcagagacatctgtgtatgtgacc
tggatcccccgtgggaatggtggatttcctatccagtctttccgcgtggaatataagaaa
cagaagaagtcgggagactgggtcctggccaccagtgacattcctccctctcgcctctct
gtggaaatcccagacctggaaaaaggcttttcctataagtttcgtgtccgagcactgaac
atcctgggagaaagtgagcccagtgcagcatctcggccatatgtggtgtctgggcacaac
aaccgagtctacgagcgccctgtggctgggccatacatcacctttacagatgccattaat
gagaccaccatcatgctgaagtggatgtatatcccagccagcaacaacaacactcccatc
catggcttttacatctactaccgccccacagacagtgacaatgacagcgactacaagaag
gatgtggtagaaggagatcgatactggcactccatcagccacctacagccagagacctca
tatgacatcaagatgcagtgcttcaatgaaggtggtgaaagcgagttcagcaatgtgatg
atctgtgaaactaaagctcgaaaatctcttggtctgccgggtcgtcttccaccctcaaca
gtggcccctcagcagcatcccccacttagcggcgggcacagtggcctggggacaggagcc
atggtggcccgttccagcgacctaccatacttgatcgtaggcgtcgtcctgggctctatt
gtactcctcattgtggccttcatccccttttgtctttggagagcctggtccaagcagaag
caaaccattgacatgggctttccaggagctggactgttggtgtcatcctgccagtacacg
atggtgcctctgaggggcatttctgctcctcgtgccaatggacatccctatgttaatggg
cagccctatgccagtggggcacatctgaacggcatctgcccctcagcaggagtggactat
gtgagcacgaagccccaagattacagtccagatgacatgcagcagtcacacgaggagacc
aatgccttgctgcaggcgagagtgctgcaaaatgggaatgcccaccaagactaccagccc
accagattgcccagttcaagaccagaagacagctctttcctgtacagtctcccagatgac
tccactcaccaacttctgcagccacaagatgactgtccacaccttcaagagcgcttcgtt
ggcctgcatcatccagtgatgggcaacaaagtgggaggttctagtttggatcctcgacga
gatccactgtttcaccatggaagcccgttctgcctaggcctagtgccagtggaagaggta
gaaagactagactgctgccagtccagaggagacctccatcccccggctccagtgctcaca
tctttgagtcaggacctaccgggacatctgaacagcagctcaccatcgctgaggcccttg
gagactcattctcctatcagttag

DBGET integrated database retrieval system